KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2555Help
Entry
Anae109_2555      CDS       T00559                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00071  Fatty acid degradation
afw00350  Tyrosine metabolism
afw00625  Chloroalkane and chloroalkene degradation
afw00626  Naphthalene degradation
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_2555
  Lipid metabolism
   00071 Fatty acid degradation
    Anae109_2555
  Amino acid metabolism
   00350 Tyrosine metabolism
    Anae109_2555
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Anae109_2555
   00626 Naphthalene degradation
    Anae109_2555
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Anae109_2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABS26756
JGI: Anae1092555
UniProt: A7HDG0
Position
complement(2960478..2961497)
Genome map
AA seq 339 aa AA seqDB search
MPKFRSVQVSEPGGTFRFVERDLPRPGRGQARIAVEACGVCRTDSAFINGAFPNVPFPLV
PGHEIAGRIDALGEDVEHWRVGERVAVGWFGGHCGTCVPCREGDLIHCEMIQVPGWAYPG
GYAEAMVVPASALAHVPDAFSAVEAAPMGCAGVATFNALRRSAARPGDLVAVLGVGGLGH
LGVQFAAKLGFETVAIARGSEIAETAKKLGVHHYIDGDAGDVPAKLQKLGGAKVVLATAS
SAKAMSATIDGLRHNGELLVLGATPEPIEVSPFQLIATSRTVHGHPSGTARDVEETLRFA
ALAGIRPMTEVRPLEEVDAAYKRLMAGDARFRMVLTMSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaattccgttcagtccaggtctccgagcccggcggtaccttcaggttcgtcgag
cgcgaccttcccaggcccggtcgcgggcaggcccgcatcgccgtagaagcgtgcggggtc
tgccggaccgactccgccttcatcaacggcgccttcccgaacgtaccgttcccgctcgtg
ccgggccacgagatcgcggggcgcatcgatgcgctcggcgaggacgtcgagcattggagg
gtcggcgagcgcgtcgcggtcggctggttcggcggccactgcggcacgtgcgtcccctgt
cgcgagggcgacttgattcactgcgaaatgattcaggtgccgggctgggcctatcccgga
ggctacgcggaagcgatggtcgtgccggcctccgccctcgctcacgtgccggacgcgttc
tcggcggtcgaggcggcgccgatgggatgcgctggggtcgcgacgttcaatgcccttcgg
cgcagcgcggctcggccaggcgatctcgtcgccgtgctcggcgtcggcggcctgggccac
ctcggcgttcaattcgctgccaagctcggattcgagaccgtggccatcgcccgcggatcg
gagatcgcggagacggcgaagaagctcggagtgcatcattacatcgacggcgacgccggg
gacgttccggcgaagctgcagaagctcgggggcgcgaaggtggtcctggccaccgcctcg
agcgcgaaggcgatgagcgccacgatcgacgggctccgccacaacggcgagctgctcgtt
cttggcgccacgcccgagccgatcgaggtgagcccattccagctgatcgcgacgagtcga
acggtgcacggacatccgtccggcacggcgcgcgacgtggaggagacgctgcggttcgcc
gcgctggccggcatccggccgatgaccgaggtccgtccgctcgaagaggtcgacgcggct
tacaagcgcctgatggccggcgacgcgaggtttcgaatggtcctgacgatgagctcctga

DBGET integrated database retrieval system