KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2573Help
Entry
Anae109_2573      CDS       T00559                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:afw00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2984025..2984696)
Genome map
AA seq 223 aa AA seqDB search
MSSDAPAAPGLLLVLSAPSGAGKTTLAHRFRATHPDAVFSVSATTRAPRGEERDGVDYHF
VAPERFDELVREGAFAEWAEVHGKRYGTLRHTVDAALAAGRIALFDIDVQGGAQIRAAWP
DAAATVLVLPPDEAELERRLRGRSTDSDEVIRRRLAAAREEISRGLDTYEFLVVNDSLED
ALAKLDAIATHVRARRQGRVDPAAAAVAGACTRERTDLREWAR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgacgcgcccgcggcccccgggctgctgctcgtcctctcggcgccctcgggg
gcgggaaagaccacgctcgcgcaccggttccgcgcgacgcatcccgacgcggtgttctcc
gtctccgccaccacgcgcgcgccgcgcggcgaggagcgggacggcgtcgactaccacttc
gtggcgccggagcgcttcgacgagctcgtccgggagggggcgttcgcggagtgggcggag
gtgcacggaaagcgctacggcacgctccgtcacaccgtcgacgccgcgctcgctgccggc
cgcatcgcgctgttcgacatcgacgtgcagggcggcgcccagatccgcgcggcgtggccc
gacgcggccgcgaccgtgctcgtgctcccccccgacgaggcggagctcgagcgccgcctg
cgcggacgctccaccgactcggacgaggtcatccgccggaggctcgccgccgcgcgcgag
gagatctcccgcgggctcgacacgtacgagttcctggtggtgaatgactcgctcgaggac
gcgctcgccaagctcgacgcgatcgccacgcacgtgcgggcgcggagacagggcagggtg
gatcccgccgccgcggccgtcgccggggcctgcacgcgagagcggaccgatctgcgcgaa
tgggcgcggtag

DBGET integrated database retrieval system