KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2766Help
Entry
Anae109_2766      CDS       T00559                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Brite
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Anae109_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3208107..3209402
Genome map
AA seq 431 aa AA seqDB search
MKKAYAAPAAAPSPAPAAVRQCLAAKVRAFIGRWSLRRGWRFTLLVLGLRPPFRLTGRPR
QPSLAAPMDRVPVLALLALALAACRSAEVRPASGPASPPAWEAENPVRPLPAAPLGSPAD
FSSVPWVTPEKVRLGRWLFYDARLSADGTISCATCHRPEHAFSEPTAVSTGIGGRQGRRK
SPPILNAAWPVYPRYFWDGRASSLAEQARGPLENEVEMGNTLEHVVLTVSRVAGYAPYFR
EAFGDPGVDIARVSEAIAAYEATRLSGNSRYDRFAAGDESALGPDERRGMELFFGRAQCA
QCHLGPSLSDAQFHNLGVGWRPPDPYVEAPIAGFADKGRYEVTGDQKDVGAFKTPTLRDC
SKHAPYMHDGSMATLEEAVLHYWRGGFPNPWLSERMTPVPMSRGDLEALVAFLRALDGEG
YADVAPRSFPQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggcatacgcggccccggcggccgcccccagcccggccccggccgcggtccgc
cagtgcctggcggcgaaggttcgagcgttcatcggtcgttggagcctccggcgcggctgg
agattcaccctgctcgtcctggggctgcgaccgccgttccgcttgaccgggcgcccgcgc
cagccttctctagccgcgcccatggaccgtgtccccgtcctcgcgctcctcgccctggcg
ctcgcggcctgccgctccgcggaggtgcgtcccgcgtccggcccggcctcgccgcccgcc
tgggaggcggagaaccccgtccgcccactcccggccgctccgctcggcagcccggccgac
ttctcgagcgtgccctgggtcaccccggagaaggtccggctcggccgctggctcttctac
gatgcccggctcagcgccgacgggacgatctcctgcgccacctgccatcgccccgagcac
gccttctccgagccgaccgccgtctcgaccggcatcggcggccgccagggccgccggaag
tcgccgcccatcctgaacgccgcgtggccggtgtacccccggtacttctgggacggacgc
gcctcgagcctcgcggagcaggccaggggtccgctcgagaacgaggtcgagatgggcaac
acgctcgagcacgtggtgctcaccgtctcgcgcgtcgccggctacgccccgtacttccgc
gaggcgttcggcgaccccggcgtcgacatcgcgcgggtgagcgaggcgatcgccgcctac
gaggcgacccggctgtcggggaactcccggtacgatcgcttcgccgcgggcgacgagtcg
gcgctcggcccggacgagcggcgcgggatggagctgttcttcgggcgggcgcagtgcgcg
cagtgccacctcggccccagcctctccgacgcgcagttccacaacctcggcgtcggctgg
cggccgccagacccctacgtggaagcgcccatcgcgggcttcgcggacaagggccgctac
gaggtgaccggcgaccagaaggacgtgggcgcgttcaagacgccgaccctgcgcgactgc
tcgaagcacgcgccgtacatgcacgacggctccatggcgacgctcgaggaggcggtgctg
cactactggcgaggcgggttcccgaacccgtggctctccgagcggatgacgccggtcccg
atgtcgcgcggcgacctggaggcgctcgtcgccttcctgcgcgcgctcgacggcgagggg
tacgccgacgtcgccccgcgatctttcccgcagtaa

DBGET integrated database retrieval system