KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3065Help
Entry
Anae109_3065      CDS       T00559                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Anae109_3065
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_3065
  Lipid metabolism
   00071 Fatty acid degradation
    Anae109_3065
  Amino acid metabolism
   00350 Tyrosine metabolism
    Anae109_3065
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Anae109_3065
   00626 Naphthalene degradation
    Anae109_3065
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Anae109_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3578334..3579350)
Genome map
AA seq 338 aa AA seqDB search
MRAIRYHGPRKPLQLEQIATPAPGPGDVLVRVSAAGVCHTELHFLSGLLDLGVAPLTLGH
EIVGRVEAVGEGVPRERVGERVILYYYAGCGRCPHCLRGDENLCDALRAEHGFVTDGGFA
EYVRVPARNAVPLPDAIGDAEAAPIGCGVTTAVHAANLAGVGLGDWVVVFGVGAVGYGLV
QVARLRGARVIAVGRTPEKLERARALGAEATVRAGVEDVAARLRELTGGRGADVVFELVA
TRETMAASSRALAKRGRLVFVGYSEDTFEIHPIQLVVGEQVVTASVGNTLAELQAAVELV
AAGRVKTVVDRVLPLERFQEGIDALAAGRLVGRAVLAP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatccgctatcacggcccgaggaagccgctgcagctcgagcagatcgccacc
ccggcgcccggcccgggcgacgtgctcgtccgggtgtccgcggcgggcgtgtgccacacc
gagctccacttcctctccgggctcctcgacctgggcgtcgcgccgctcacgctcgggcac
gagatcgtcgggcgcgtcgaggcggtcggcgagggcgtcccacgcgagcgcgtcggagag
cgggtcatcctgtactactacgcgggctgcggccgctgcccgcactgcctgcggggcgac
gagaacctgtgcgacgccctgcgggcggagcacgggttcgtgaccgacggcggcttcgcc
gagtacgtgcgggtcccggcgcggaacgcggtgcccctgcccgacgcgatcggcgacgcg
gaggcggcgcccatcgggtgcggggtcaccaccgcggtgcacgccgcgaacctcgccggc
gtcgggctgggcgactgggtggtggtgttcggcgtcggggcggtggggtacgggctcgtg
caggtcgcgcggctccgcggcgcgcgcgtgatcgcggtcggccgcacgccggagaagctc
gagcgggcgcgcgcgctgggagcggaagcgacggtgcgcgccggcgtggaggacgtcgcc
gcgcggctccgggagctcaccggcgggcgcggcgccgacgtggtgttcgagctcgtcgcg
acgcgcgagacgatggccgcgagctcccgcgccctcgccaagcgcgggaggctcgtcttc
gtcggctactcggaggacacgttcgagatccaccccatccagctggtggtcggcgagcag
gtcgtcaccgcctcggtggggaacacgctcgccgagctccaggcggcggtggagctcgtc
gccgccgggcgcgtgaagacggtggtcgaccgcgtcctgccgctcgaacgcttccaggag
ggcatcgacgcgctcgccgcgggccgcctcgtcggccgcgccgtgctcgcgccctga

DBGET integrated database retrieval system