KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3070Help
Entry
Anae109_3070      CDS       T00559                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anae109_3070
Enzymes [BR:afw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Anae109_3070
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3584312..3587965)
Genome map
AA seq 1217 aa AA seqDB search
MDASLSRLTTTGPWDELLHGPGRAGLEAALPPYLVGRRWFGGKARRIQRVELLDAAPVGP
GPGASRLVFLRVSYGDSAPEVYSLPLAFAPGPWADRVHGAWPGSEVALLEAGGEQGVLYA
TDRDPAFSRALLDAIAHGRTLKGRGGEIVAWSTRAFARRSEGVEELVPTPLGGEQSNTSI
RFGDRMILKLFRRTEAGPNPELEVGAYLTERAAFPNVPAVLGAVEYRPRGGEPHVLALLQ
AFVPNRGDAWEFTLAELSAFLDRAAGRAPPAAPAAALVELAGVAPPPELRALAAPSLDAA
ALLGRRTAELHLALARGVDEEAFRPEPFSREDRRRLHDGARAQVRAALALLRRRRDVLPP
EVRARAEAVLAREDELELGLRWVLDRPLTALRTRTHGDFHLGQVLRTGGDYVVIDFEGEP
ARPMAERRAKASPLRDVAGMVRSLHYAAHAGPARRAERPDAAPGEAAHAQAWARVWYAWV
AASFLRAYLDAARGARFLPAGGELRELLALYLTEKALYELAYELNNRPDWVRLPLEGIAE
LLGAAEAGAREREDALPTKGTREAPRAAAREAREGGAPGAVLARGGPGELDRHLWNEGTN
HRAYRTLGAHPQTIDGAAGTSFTVWAPNAERVSVIGDFNGWDKERHPLRRIDDSGLWQGF
LPGVGKGAVYKYHLRSRERGYAVDKADPFGFMHETAPGTQSIVWDLAYAWGDDAWMRARR
ERNGLASPMSVYEVHLGSWRRVPEEGNRPLTYRELAPLLADHVAALGFTHVELLPVTEHP
FYGSWGYQTTGYFAPTSRYGTPQDFMFLVDTLHQRGIGVILDWVPSHFPTDEHGLAYFDG
THLFEHADRRQGHHPDWDSFIFNYGRNEVRSFLLSSALFWLDAYHADGLRVDAVASMLYL
DYSRKHGEWIPNKYGGRENLEAIDFLRRFNEVVYAEYPDVQTIAEESTSWPMVSRPLYVG
GLGFGMKWDMGWMHDTLAYMGHDPVFRKFHHNEVTFRMMYAFSENFVLALSHDEVVHGKR
SLLGRMPGDAWQKLANLRLLYAYQWAQSGKKLLFMGGELAQGQEWSHERSLDWHLLGIEG
HAGVRTWVEDLNRLMRENPALHVRDFEPAGFEWIDANDAEASVLSFLRKGREGDPEILVV
LNFTPVARPNYRVGVPRGGFWREVLNSDAQRYGGSGWGNLGGQEAAPVGAHGRLHSLSLT
LPPLGALFFRHEPAGER
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttcgctctcgaggctcacgacgacgggaccgtgggacgagctcctgcacggc
ccggggcgggcgggcctggaggcggcgttgccgccttacctcgtcggccgccgctggttc
ggcggaaaggcccggcgaatccagcgggtcgagctcctcgacgcggcgccggtggggccg
gggccaggggcgtcgcgcctggtcttcctgcgcgtgagctacggggactcggcgccggag
gtgtactcgctcccgctcgcgttcgcgcccggcccgtgggccgacagggtccacggcgcc
tggcctggctcggaggtggcgctgctcgaggccggaggtgagcagggcgtcctgtacgcc
acggatcgcgatccggcgttctcgcgggcgctcctcgacgccatcgcccacgggcgcacg
ctgaagggccgggggggcgagatcgtcgcctggtccacgcgcgcgttcgcgcggcgctcg
gagggggtggaggagctcgtcccgacgcccctgggcggcgagcagagcaacacctcgatc
cgcttcggggatcggatgatcctgaagctcttccggcggacggaggccggcccgaacccg
gagctggaggtcggcgcctacctcaccgagcgcgccgcgttcccgaacgtaccggcggtg
ctcggcgcggtggagtaccggccgcgcggcggcgagccccacgtcctcgcgctcctccag
gcgttcgtcccgaaccggggggacgcgtgggagttcacgctcgccgagctgagcgcgttc
ctcgatcgcgccgccggccgcgcgccccccgcggcccccgccgccgcgctcgtggagctc
gcgggcgtcgcgccgcctcccgagctccgcgcgctcgccgcgccgtcgctcgacgccgcc
gcgctgctcggccgccggacggcggagctgcacctcgcgctcgcgcgcggcgtggacgag
gaggcgttccgccccgagccgttctcgcgcgaggaccgtcgccggctccacgacggcgcc
cgcgcgcaggtccgcgccgcgctcgcgctgctgcggcgacgccgcgacgtgctcccgccc
gaggtgcgcgcgcgcgccgaggccgtcctcgcgcgcgaggacgagctcgagcttggcctc
cgctgggtgctcgaccggccgctgaccgccctgcggacgcggacgcacggtgacttccac
ctcggccaggtgctcaggacggggggcgactacgtggtgatcgacttcgagggggagccc
gcgagaccgatggcggagcggcgcgccaaggcgtctccgctgcgggacgtcgcggggatg
gtgcgctcgctccactacgcggcgcacgcgggcccggcgcgccgcgcggagcggccggac
gccgcgccgggcgaggcggcgcacgcgcaggcgtgggcccgggtgtggtacgcgtgggtg
gccgcgagcttcctgcgcgcgtacctggacgccgcccgaggcgcccggttcctgcccgcg
ggaggggagctgcgggagctcctcgcgctgtacctcacggagaaggcgctgtacgagctc
gcctacgagctcaacaaccggccggactgggtccggctgccgctggaagggatcgccgag
ctgctcggcgcggcggaggccggagcccgggagcgggaggacgcgttgccgaccaaggga
acgagggaggcgccgcgagcggcggcgcgagaggcgcgggaaggcggggcgccgggggcg
gtgctcgcgcgcggcggacccggcgagctcgaccggcacctctggaacgaggggacgaac
caccgcgcctaccgcaccctgggtgcgcatccgcagacgatcgacggcgcggcggggacg
tcgttcaccgtgtgggccccgaacgccgagcgggtgagcgtcatcggggacttcaacggc
tgggacaaggagcggcacccgctccggcggatcgacgactcgggcctgtggcagggcttc
ctgcccggcgtggggaagggggccgtctacaagtaccacctgcgctcgcgggagcgcggc
tacgcggtggacaaggcggacccgttcggcttcatgcacgagacggccccggggacgcag
tcgatcgtctgggacctcgcctacgcgtggggcgacgacgcgtggatgcgcgcgcgccgc
gagcggaacgggctcgcgagcccgatgagcgtctacgaggtgcacctgggctcgtggcgc
cgcgtgcccgaggaggggaaccggccgctcacctaccgcgagctggcgccgctcctcgcc
gatcacgtcgcggccctgggcttcacccacgtcgagctgctccccgtcaccgagcacccg
ttctacggctcatggggctaccagacgacgggctacttcgcgcccacgagccgctacggg
acgccgcaggacttcatgttcctcgtggacacgctccaccagcgcgggatcggcgtcatc
ctggactgggtgccgtcgcacttcccgaccgacgagcacggcctcgcctacttcgacggc
acgcacctcttcgagcacgccgatcggcgccagggacaccacccggactgggacagcttc
atcttcaactacgggcggaacgaggtgcggagcttcctgctctcctcggcgctcttctgg
ctcgacgcgtaccacgcggacgggctccgcgtggacgcggtcgcgtcgatgctctacctg
gactactcgcgcaagcacggtgagtggatcccgaacaagtacggcggccgcgagaacctc
gaggcgatcgacttcctgcgccgcttcaacgaggtggtgtacgcggagtacccggacgtc
cagacgatcgcggaggagtcgacctcctggcccatggtgtcccgcccgctctacgtcggc
ggcctgggcttcgggatgaagtgggacatgggctggatgcacgacacgctcgcgtacatg
ggccacgatccggtgttccggaagttccatcacaacgaggtgaccttccggatgatgtac
gccttctcggagaacttcgtgctcgccctctcgcacgacgaggtggttcacggaaagcgc
tccctgctcggccggatgccgggggacgcctggcagaagctcgcgaacctgcgcctgctc
tacgcgtaccaatgggcgcagtccgggaagaagctgctcttcatgggcggtgagctcgcg
caggggcaggagtggagccacgagcggagcctcgactggcacctcctcgggatcgagggg
cacgcgggggtgaggacctgggtcgaggatctgaaccggctcatgcgcgagaacccggcg
ctgcacgtccgcgacttcgagccggcgggcttcgagtggatcgacgccaacgacgccgag
gcgagcgtgctctcgttcctgaggaaggggcgggagggcgacccggagatcctcgtggtc
ctcaacttcacccccgtcgcccgcccgaactaccgggtgggcgtgccgcgcggcggtttc
tggcgcgaggtcctgaacagcgacgcgcagcgctacggcgggagcgggtgggggaacctg
ggcgggcaggaggccgcgccggtgggcgcgcacgggcggctccattcgctgtccctcacg
ctgccgcccctgggcgcgctgttcttccgccacgagccggcgggcgagcgctga

DBGET integrated database retrieval system