KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3076Help
Entry
Anae109_3076      CDS       T00559                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Anae109_3076
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Anae109_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3596262..3597884)
Genome map
AA seq 540 aa AA seqDB search
MPSALDYDFIVIGSGFGGAVSALRLSEKGYRVAVLEMGKRWGQDDFAATNWNLRKSLWMP
RLLCYGIQQISVLKHVLVLHGAGVGGGSLVYANTLLVPAARAFRDPRWPGSEDWSEKLAP
HYATARFMLGARPARETFPADELLREAVEEETGRGSTFARHTVGVYYGGEAGRTDPDPYF
GGEGPARTGCTLCGGCMTGCRHGAKNTLDRNYLFLAERRGCVIHAETKVTDVRPMPEGGY
EVRTVRSTRPLSVGSRVLRARGVVLSAGALGTVSLLLGCKERGSLARLSDRLGDYVRTNS
EALLAVTARRGDVDYSRGIAITSGVDADDDTHVEIVRYGAGHDAMALLSTHLTGHGPPWP
RWLRWIGNAFRHPLDFLRAHWPFGWARRTAVLLVMQPLSSHMRLRLARRPWGRALTTALS
DGQRPPTYMPLANALARRLARKMDGVPQSGLHEVLLGASSTAHILGGATMGASPAEGVCD
SGGRVFGYEHLYVADGSLVPANLGVNPSLTITALAEHVMSGIPANPEGTPKPAPRPPSGG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtgcccagcgcgctcgactacgacttcatcgtcatcggctccggcttcggcggggcggtc
tccgccctgcggctctccgagaagggctatcgcgtcgcggtgctggagatggggaagcgc
tgggggcaagacgacttcgccgcgacgaactggaacctgcgcaagtcgctgtggatgccg
aggctgctctgctacgggatccagcagatctccgtcctgaagcacgtgctcgtcctgcac
ggcgcgggcgtcggcggcggcagcctcgtctacgcgaacacgctcctcgtcccggcggcg
cgcgcgttccgggatccgcgctggcccgggagcgaggactggagcgagaagctcgccccg
cactacgcgaccgcccggttcatgctgggcgcgaggcccgcgcgggagaccttccccgcg
gacgagctgctccgcgaggccgtggaggaggagaccggacgcgggagcacgttcgcgcgc
cacacggtcggcgtgtactacggcggcgaggcggggcgcaccgatcccgatccgtacttc
ggcggcgagggccccgcgcgcactggctgcaccctgtgcggcggctgcatgacggggtgc
aggcacggcgcgaagaacacactcgaccggaactacctcttcctcgccgagcggcgcggg
tgcgtcatccacgccgagaccaaggtcaccgacgtccggccgatgccggagggcggctac
gaggtgcgcaccgtccgctccacgcgcccgctctccgtgggctcgcgcgtgctccgagcg
cgcggggtcgtgctctccgccggcgcgctcgggaccgtgagcctgctcctgggatgcaag
gagcgcggcagcctcgcgcgcctgagcgaccggctcggcgactacgtgcgcacgaacagc
gaggcgctgctcgccgtcaccgcgcggcgcggcgacgtcgactacagccgcgggatcgcc
atcacctccggcgtggacgcggacgacgacacccacgtcgagatcgtccgctacggcgcc
ggccacgacgccatggccctgctctcgacgcacctcaccggccacggcccgccctggccg
cgctggctgcgctggatcggcaacgcgttccgccacccgctcgacttcctgcgcgcgcac
tggccgttcggctgggcgcgtcgcaccgccgtgctgctcgtcatgcagccgctctcgagc
cacatgcgcctgcggctcgcgcggcgtccgtgggggagggcgctcaccacggcgctctcg
gacgggcagcggccgccgacgtacatgcccctcgcgaacgcgctcgcccggcggctggcg
cgcaagatggacggcgtgccgcagagcgggttgcacgaggtgctcctcggcgcctccagc
accgcccacatcctgggcggcgcgaccatgggcgcctcgccggcggagggcgtctgcgac
agcggggggcgggtcttcggctacgagcacctctacgtcgcggacggcagcctcgtcccg
gcgaacctgggcgtgaacccgtcgctcaccatcaccgccctcgccgagcacgtgatgagc
gggatcccggcgaaccccgagggcacgccgaagccggcgccgcgaccgccgtcgggcggg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system