KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3461Help
Entry
Anae109_3461      CDS       T00559                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00620  Pyruvate metabolism
afw00640  Propanoate metabolism
afw00680  Methane metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_3461
   00620 Pyruvate metabolism
    Anae109_3461
   00640 Propanoate metabolism
    Anae109_3461
  Energy metabolism
   00680 Methane metabolism
    Anae109_3461
Enzymes [BR:afw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Anae109_3461
Lipid biosynthesis proteins [BR:afw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Anae109_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABS27645
JGI: Anae1093461
UniProt: A7HFZ9
Position
4066122..4068017
Genome map
AA seq 631 aa AA seqDB search
MPKPQQLEGEVFHPSSEIVSQARVKDWESLARRADEDLEGFWAAEAEELEWYRKWDKVLD
ASEKPFFKWFQGAQTNIVHNCLDRHQRTWRKNKLSLVWVGEKGEVRTYSYFALNRDVSKF
ANVLKAMGVRKGDRVTIYMPRIPEIVIAMLATAKIGAIHSVVYGGFSVDALQGRIEDSES
KVVLTADGGFMNGKIVELKKTVDDAVRRCPTVETVIVVQRTGHEVRMEPGRDYWYHELMK
LPLATGHCPTEVMESSDPLYVLYTSGTTGKPKGLVHGHGGYMVGIYSTLKYVFDVKDEDR
YWCAADPGWVTGHSYIVYGPLLMGATTFIYEGAPTYPYPNRWWSLVEKYGITILYTAPTA
IRGLMRFGESWPNRHDLSTLRLLGSVGEPINPEAWKWYHRVIGKGRCPIMDTWWQTETGM
FQITPVPTMPLKPGSAARPFFGQHAEILDEQGKPVPDGEEGYLVLDRPWPAMATTIYRDP
ERFVRTYWSRYPGKYMAGDSAKRDRDGYYWVIGRTDDVIKVSGYRLGTAEIESALVSHPA
VAEAAVIGLPHEVKGQAIHAYCLLRQGFKASPELEDEVKTHVAQHLGPIVRPEKVSFVDV
LPKTRSGKIMRRVLKARAQGLPEGDVSTLEE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagccgcagcagctcgagggcgaggtgttccacccgtcctcggagatcgtctcc
caggcccgcgtgaaggactgggagtcgctcgcgcgccgcgccgacgaggatctcgagggc
ttctgggctgcggaggccgaggagctcgagtggtaccgcaagtgggacaaggtgctcgac
gcgtcggagaagcccttcttcaagtggttccagggcgcccagacgaacatcgtccacaac
tgcctcgaccggcaccagcgcacctggcggaagaacaagctctcgctcgtgtgggtcggc
gagaagggcgaggtccgcacctactcgtacttcgcgctcaaccgggacgtctcgaagttc
gcgaacgtgctgaaggcgatgggggtgaggaagggcgatcgcgtcaccatctacatgccc
cgcatccccgagatcgtgatcgccatgctggcgaccgccaagatcggcgccatccactcg
gtcgtgtacggcgggttctccgtcgacgcgctccaggggcgcatcgaggactcggagtcg
aaggtcgtcctgaccgccgacggcgggttcatgaacgggaagatcgtcgagctcaagaag
acggtggacgacgcggtccgccgctgcccgaccgtcgagaccgtcatcgtggtgcagcgc
accggccacgaggtccggatggagcccgggcgcgactactggtaccacgagctcatgaag
ctccccctcgcgacgggccactgcccgaccgaggtgatggagtcctccgatcccctctac
gtgctctacacgtccggcacgaccggcaagcccaaggggctggtgcacgggcacggcggg
tacatggtcgggatctactccacgttgaagtacgtcttcgacgtgaaggacgaggaccgc
tactggtgcgccgccgatccgggctgggtgaccggccacagctacatcgtgtacggaccc
ctgctcatgggggcgacgaccttcatctacgagggcgcgccgacctacccgtacccgaac
cgctggtggtcgctcgtcgagaagtacggcatcaccatcctctacacggccccgaccgcg
atccgcgggctcatgcgcttcggcgagtcctggcccaaccgccacgacctctccacgctg
cggctgctcggctcggtcggagagcccatcaaccccgaggcgtggaagtggtaccaccgc
gtcatcgggaagggccgctgcccgatcatggacacctggtggcagacggagaccgggatg
ttccagatcacgcccgtcccgaccatgccgctcaagccgggctcggcggctcgcccgttc
ttcggccagcacgcggagatcctcgacgagcagggcaagcccgtgcccgacggcgaggag
ggctacctcgtcctggaccggccctggcccgccatggccacgacgatctaccgggacccg
gagcgcttcgtccgcacgtactggagcaggtaccccggcaagtacatggccggcgactcc
gcgaagcgcgaccgcgacggctactactgggtcatcggccgcaccgacgacgtcatcaag
gtgtccggctaccggctcggcaccgccgagatcgagagcgcgctggtctcccaccccgcc
gtggcggaggcggcggtcatcgggctaccgcacgaggtgaaggggcaggcgatccacgcc
tactgcctgctccgccagggcttcaaggcgagccccgagctcgaggacgaggtgaagacc
cacgtcgcgcagcacctcgggcccatcgtccgaccggagaaggtgagcttcgtcgacgtg
ctgccgaagacccgctccggaaagatcatgcgccgggtgctgaaggcgcgcgcgcagggg
ctccccgagggcgacgtctcgaccctggaggagtga

DBGET integrated database retrieval system