KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3532Help
Entry
Anae109_3532      CDS       T00559                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw02020  Two-component system
afw02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:afw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anae109_3532
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Anae109_3532
Enzymes [BR:afw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Anae109_3532
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Anae109_3532
Two-component system [BR:afw02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Anae109_3532
Bacterial motility proteins [BR:afw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Anae109_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABS27713
JGI: Anae1093532
UniProt: A7HG67
Position
complement(4137764..4138876)
Genome map
AA seq 370 aa AA seqDB search
MIRCLVVDDARAFRAVLREILSSAPGVEVVGEAGDGREAVSLVRALRPDVVTMDVRMPRL
DGLAALEEIMRVAPTPVVVVSAEAGGEAQQLSFRALQLGAIEVLAKPRDPGTPRFERQAE
AIRQAVRAVAGLLLVGRRRPARPARPAPLAGEPPRREEPRRPAPLVPARLEPPGGARPEV
LAIAASTGGPAALASILAPLPRDLPLPLLVVQHIAPGFEPELARWLDTLTPLTVRLAVDG
APLAAGTVHLAAGGRHLGVRGRTIRLSDEPAVHGFRPSGTHLFSSVARELGARGAGMVLS
GMGSDGAEGLAALRRAGGYTAAQSAASSVVYGMPRAALERGAAAHELELDEIPGEILRLA
GREARATDRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctgcctcgtcgtcgatgacgcgcgcgccttccgcgcggtgctccgcgagatc
ctctcctccgcccccggcgtggaggtggtgggtgaggcgggggacgggcgcgaggcggtg
tcgctcgtgcgggcgctccggcccgacgtcgtcaccatggacgtgcgcatgccccgcctc
gacggcctcgccgcgctcgaggagatcatgcgcgtggcgccgacccccgtggtggtggtg
agcgccgaggcgggcggggaggcgcagcagctctccttccgagcgctgcagctcggcgcg
atcgaggtgctggcgaagccgcgcgatccgggcacgccgcgcttcgagcggcaggcggag
gcgatccgccaggccgtgcgcgccgtcgccgggctgctgctggtcgggcgcaggcgcccc
gcccggcccgcccggcccgccccgctcgccggcgagccgccgcgtcgcgaggagccgcgc
cggccggcgcccctcgtccccgcacggctggagccgccgggtggtgcgcggccggaggtg
ctcgccatcgcggcgtccacaggggggcccgcggcgctcgcgagcatcctcgcgccgctg
ccgcgagacctgccgctgccgctgctcgtggtgcagcacatcgcgcccgggttcgagccg
gagctcgcgcgctggctcgacaccctcactcctctcacggtgcggctcgccgtcgacggc
gcaccgctcgcggcggggaccgtccacctcgccgccggcgggcggcacctcggcgtccgc
ggccggaccatccggctctccgacgagcccgccgtgcacgggttccggccctccggaacg
cacctgttctcgtcggtggcccgagagctcggggcgcggggcgcggggatggtgctgtcg
ggcatggggagcgacggcgccgaggggctcgcggcgctgcgccgcgcgggcggctacacc
gccgcccagagcgctgcctcctccgtggtctacggcatgcccagggcggccctggagcgc
ggcgccgcggcgcacgagctcgagctcgacgagatcccaggggaaatcctgcggctcgcc
gggcgcgaggcccgcgccaccgaccgcgcgtga

DBGET integrated database retrieval system