KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3566Help
Entry
Anae109_3566      CDS       T00559                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Anae109_3566
Enzymes [BR:afw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Anae109_3566
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4180627..4182105)
Genome map
AA seq 492 aa AA seqDB search
MASYVMAIDQGTTGTTVLILDKRLAPRARVNQEFRQIFPKPGWVEHDLDDLWGSTVATVQ
RALREAGLRGREIAAIGITNQRETTAAWDRLSGRALHHAIVWQDRRTTDACASLKAEGHE
QRVREKTGLVIDPYFSATKMRWLLDNVRGLRERAESGAAAFGTIDSYLVWRLTNGGTHVT
DVSNASRTLLMDIRARAWDRELLDLFGVPRSVLPEIVPSSHVYGTTRNVKDLPDGIPIAG
MAGDQQAALFGQACFTPGEAKCTYGTGAFLLQNVGGEPVQSSRGLLTTVAWDVGGEVTYA
LEGSSFIAGAAVQWLRDGLRLFKKTPEVEALAKQVKDTGDLVFVPALAGLGAPHWRPEAR
GVIRGIDRGVSAAHLARATLEGIAFLIYDLAEAMRAEAGKAYPVFKVDGGASQNDLLMQF
QADLLDVPVERPRMIDTTALGAAFLAGLAIGFWKDREEIRRAWKVGKRFEPKMKAVEREA
HLAKWRRAVQSA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctacgtcatggcgatcgaccaggggacgacgggcaccaccgtcctcatcctc
gacaagcggctcgcgccccgcgcccgcgtgaaccaggagttccggcagatcttcccgaag
cccgggtgggtggagcacgatctcgacgacctctggggctcgacggtcgcgacggtgcag
cgcgcgctgcgcgaggcgggcctgcgcgggcgcgagatcgcggccatcgggatcacgaac
cagcgcgagaccaccgcggcgtgggaccggctctcggggcgcgcgctccaccacgccatc
gtctggcaggaccgccgcaccaccgacgcgtgcgcgtcgctcaaggcggaggggcacgag
cagcgcgtgcgggagaagaccgggctcgtcatcgacccctacttctccgccaccaagatg
cgctggctgctcgacaacgtccgcggcctgcgcgagcgggccgagtccggcgccgccgcg
ttcggcaccatcgacagctacctcgtctggaggctcacgaacggcgggacgcacgtgacc
gacgtctccaacgcgagccgcacgctcctcatggacatccgcgcgcgggcgtgggaccgc
gagctgctcgacctcttcggcgtgccgcgcagcgtgctgcccgagatcgtcccctcctcg
cacgtctatggcaccacccggaacgtgaaggacctgccggacgggatccccatcgcgggg
atggcgggcgaccagcaggcggcgctgttcggccaggcgtgcttcacgcccggcgaggcg
aagtgcacctacggcaccggggcgttcctgctccagaacgtggggggcgagccggtgcag
tcctcgcgcggcctgctcaccaccgtcgcctgggacgtcggaggcgaggtgacctacgcg
ctcgagggctcctcgttcatcgccggggcggcggtgcagtggctgcgcgacgggctccgg
ctgttcaagaagacgccggaggtggaggccctcgcgaagcaggtgaaggacacgggcgac
ctcgtgttcgtccccgcgctcgccgggctgggcgccccgcactggcggcccgaggcgcgc
ggggtgatccgcggcatcgaccgcggcgtctccgccgcgcacctcgcccgcgccaccctc
gagggcatcgcgttcctcatctacgacctcgcggaggcgatgagggccgaggcgggcaag
gcttaccccgtgttcaaggtggacggcggcgcctcgcagaacgacctgctcatgcagttc
caggcggacctgctcgacgtcccggtcgagcggccgcgcatgatcgacaccaccgcgctg
ggcgccgccttcctcgccggcctcgccatcggcttctggaaggatcgcgaggagatccgc
cgggcctggaaggtgggcaagcgcttcgagccgaagatgaaggccgtcgagcgcgaggcg
cacctggcgaagtggcgccgggcggtgcagagcgcctag

DBGET integrated database retrieval system