KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3567Help
Entry
Anae109_3567      CDS       T00559                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4182108..4182986)
Genome map
AA seq 292 aa AA seqDB search
MARTGIEHGREFELRGGPDAVLLLHGLTGSTFEMHVVARRLAEQGMRCLAPVMAGHGGEA
RDLLGVPWPEWVAKARRDLARLEGARRTFVVGCSMGALVACALAHDHPERVDGLVLLAPA
LELQLHGRLAALLGRHAPLSRLVVPKTAGSDVSDPEQRERNRVATLEGVPLAAVAQLRAL
ADHVDRQLPGIAAPALVVAGAHDHTVTVAGARRLARRIGSGPAHLVVLPDSFHLVGIDVE
RDLCADEAARFLEGLPVPGARAAGKPRPKGRARKDRTGGTSGRGQGRRPRAR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgcaccggcatcgagcacgggagggagttcgagctgcgcggcggcccggacgcc
gtgctgctgctgcacggcctgaccggctccacgttcgagatgcacgtcgtcgcgcgccgc
ctcgccgagcaggggatgcgctgcctcgcgccggtgatggcgggccacggcggcgaggcg
cgggacctgctcggcgtgccctggcctgagtgggtcgcgaaggcgcgccgggatctcgcg
cggctcgagggggcgcggcgaacgttcgtggtcggctgctccatgggcgcgctcgtcgcc
tgcgcgctggcccacgatcaccccgagcgcgtggacggcctcgtcctgctcgcccccgcg
ctcgagctccagctccacgggaggctggccgcgctgctcgggcgacacgccccgctctcg
cgcctggtggtcccgaagacggcgggctcggacgtcagcgaccccgagcagcgcgagcgc
aaccgcgtcgccacgctcgagggcgtgccgctcgcggcggtggcgcagctgcgcgccctc
gccgatcacgtggaccggcagctccccgggatcgccgcgccggctctggtcgtggcgggc
gcgcacgatcacaccgtgaccgtcgcgggcgcgcggcggctcgcgcgccgcatcgggagc
ggccccgcccacctcgtcgtcctgccggacagctttcacctcgtgggcatcgacgtggag
cgcgacctctgcgcggacgaggcggcgcgcttcctcgaaggtcttccggtgccgggcgcg
cgcgcggcggggaagccgcggccgaaggggagggcgcgcaaggatcgcaccggcggcacg
agcgggcgcgggcaggggcggcgtccgcgcgcgaggtga

DBGET integrated database retrieval system