KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3579Help
Entry
Anae109_3579      CDS       T00559                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Anae109_3579
   00052 Galactose metabolism
    Anae109_3579
   00500 Starch and sucrose metabolism
    Anae109_3579
   00520 Amino sugar and nucleotide sugar metabolism
    Anae109_3579
Enzymes [BR:afw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Anae109_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4193308..4194189
Genome map
AA seq 293 aa AA seqDB search
MPGTMANRTIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDVV
LVVARGKESIVDHFDIAAELEAHLERTGKHELKRQMRSIAQMANVITVRQQEPLGLGHAV
LCARDVIGDEPFVVMLGDDIIDAKVPGAKQLADCYAKHGLATVALMEVPPEETSMYGIAA
GTELEPRTIEVERIVEKPKQDPPSNLAVIGRYVLPPRIFEVLDQVEPGVGGEIQLTDALA
VLAREESLLGYRFEGDRYDAGDRLGYLKANLAFALKRPELAGPLRELMKEMSR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgccgggcaccatggcgaaccggaccatccgcaaggccgtcatccctgcagccggcctc
ggcacgcgcttcctccccgcgacgaaggccgtcccgaaggagctgctccccatcgtggac
acgcccacgatccagtacatcgtcgccgaggcggtggcggcgggcgtgcgcgacgtcgtg
ctcgtggtcgcccgcggcaaggagtcgatcgtcgatcacttcgacatcgccgcagagctc
gaggcgcacctcgagcggaccggcaagcacgagctgaagcgccagatgcgctccatcgcg
cagatggcgaacgtcatcaccgtccggcagcaggagcccctcggcctcgggcacgccgtg
ctgtgcgcgcgcgacgtcatcggcgacgagccgttcgtcgtgatgctcggggacgacatc
atcgacgccaaggtccccggcgcgaagcagctcgccgactgctacgcgaagcacgggctc
gccacggtggccctcatggaggtcccgcccgaggagacctcgatgtacggcatcgcggcg
ggcaccgagctcgagccgcgcacgatcgaggtggagcgcatcgtcgagaagccgaagcag
gatccaccctcgaacctggcggtgatcggccggtacgtgctccctccgcgcatcttcgag
gtgctggatcaggtcgagcccggggtgggcggcgagatccagctcaccgacgccctcgcg
gtgctcgcgcgcgaggagagcctgctcgggtaccgcttcgagggcgaccgatatgacgcc
ggcgaccggttggggtatctcaaggcgaacctcgccttcgcgctgaagcgcccggagctg
gcgggcccgctgcgcgagctcatgaaggagatgtcccgttga

DBGET integrated database retrieval system