KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3605Help
Entry
Anae109_3605      CDS       T00559                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:afw00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:afw00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4222047..4223321
Genome map
AA seq 424 aa AA seqDB search
MSSSLAAAPRAAPAVADRSPALSPLVCRRCGARFDPLPVAVCEECVGPLEPAYAPDRRLP
TRAEIEARPRSIWRYREWLPILGEPVLSLDTGFTPLLDSPPLARALGVRRALVKNDAVSH
PTQSFKDRVVAVALNAAIGLGLDTVGCASTGNLANAVAAQAARAGLAAWIFVPEDLELAK
IVGTAVYGPRLVRVRGTYDDVNRLCAQVADRFGWGLVNLNLRSYYGEGSKTMAFEIAEQL
GWRLPDAVIAPMAGGSLLTKLDKGFHELSDAGLVAPGAPRMYGAQASGCAPIVNLVERGG
DTIEPVIPRTIARSIAIGNPADGTFAARAIRGSGGAAAAVTDEELVEGIRLLAETTGVFT
ETAGGVTVAAARRLAREGKLRASDEVVLCITGNGLKTIDAVVPALPEAPVVSAKLREVAA
LVNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtccctcgcggccgcgccccgcgcggcgcctgccgtcgccgatcgctccccg
gcgctgtctcccctcgtgtgccgccgctgcggcgcccggttcgatcccctccccgtggcg
gtgtgcgaggagtgcgtcgggccgctcgagcccgcgtacgcgcccgatcgccgcctgccc
acgcgcgcggagatcgaggcgcgcccccggtcgatctggcgctaccgcgagtggctcccg
atcctgggcgagccggtgctctcgctcgacaccggcttcacgcccctgctcgactccccg
cccctcgcccgcgcgctgggcgtccgccgcgcgctcgtgaagaacgacgccgtctctcac
cccacccagtcgttcaaggaccgggtggtggcggtggcgctcaacgcggcgatcggcctc
gggctcgacaccgtcggctgcgcctccaccggcaacctcgccaacgcggtggcggcccag
gcggcccgcgccggcctcgccgcgtggatcttcgtgcccgaggacctcgagctcgccaag
atcgtggggacggcggtgtacggaccccgcctcgtgcgcgtgcgcgggacgtacgacgac
gtgaaccggctgtgcgcgcaggtggcggaccgcttcggctggggcctcgtgaacctgaac
ctccgcagctactacggtgagggctcgaagacgatggcgttcgagatcgcggagcagctc
gggtggcggctgccggacgcggtgatcgcgccgatggccggcggctcgctgctcacgaag
ctcgacaagggcttccacgagctctccgacgcgggcctcgtcgccccgggcgcgccgcgc
atgtacggcgcccaggcgtccggctgcgcgcccatcgtgaacctcgtggagcgcggcggc
gacacgatcgagccggtcatcccgcgcaccatcgcgcgctccatcgccatcgggaacccg
gccgacgggacgttcgccgcgcgcgccatccgcggctcgggcggcgccgccgcggcggtc
accgacgaggagctcgtcgaggggatccggctgctcgccgagaccaccggcgtgttcacc
gagaccgccggcggcgtcaccgtcgccgccgcgcgccgcctcgcccgggaggggaagctg
cgcgcctccgacgaggtcgtcctctgcatcaccgggaacggcctcaagaccatcgacgcg
gtcgtcccggcgctgccggaggcgccggtcgtctccgccaagctccgcgaggtcgcggcg
ctcgtgaacgcctga

DBGET integrated database retrieval system