KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3760Help
Entry
Anae109_3760      CDS       T00559                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Anae109_3760
DNA repair and recombination proteins [BR:afw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Anae109_3760
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Anae109_3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4382870..4383466)
Genome map
AA seq 198 aa AA seqDB search
MAVADPIARLVKELAKLPGIGEKTAQRLAFHILKAGPGYAGELAGAIAGVVRDVRLCSEC
QTLTDKDPCAVCADPRRDSRIICVVEGVPDLLAVERTHEFRGRYHVLHGALSPLDGIGPS
ELKIRELLLRLEREPAEEIVVATNPDVEGEATALYLTKLLKPLGVKVTRIAQGIPMGGDL
EYADQVTLARALAGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcggatcccatcgctcggctcgtgaaggagctcgcgaagctgcccggcatc
ggcgagaagaccgcccagcggctcgcgttccacatcctcaaggcgggccccggctacgcg
ggcgagctcgcgggcgcgatcgccggcgtggtccgcgacgtgcgcctctgctcggagtgc
cagaccctcaccgacaaggacccgtgcgccgtgtgtgcggacccgcgccgcgactcgcgg
atcatctgcgtcgtcgagggggtcccggatctcctcgccgtcgagcgcacccacgagttc
cgcggccggtaccacgtgctccacggcgcgctctcgccgctcgacggcatcggaccgtcc
gagctcaagatccgcgagctgctcctgcgcctggagcgcgagcccgccgaggagatcgtc
gtcgccacgaacccggacgtcgagggcgaggcgaccgcgctctacctcaccaagctgctg
aagccgctcggcgtgaaggtcacgcgcatcgcccagggaattcccatgggcggtgatctc
gaatacgctgatcaggtcacgctggcgcgcgcactggcaggacgccgagagctctga

DBGET integrated database retrieval system