KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_3879Help
Entry
Anae109_3879      CDS       T00559                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Anae109_3879
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Anae109_3879
Enzymes [BR:afw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Anae109_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4524761..4526365
Genome map
AA seq 534 aa AA seqDB search
MCRAAPWCVSRRTRRRVTGRAHRGRDSGRRLAFRCGDMKLSAVIQGTGARGEAADDHEIV
LVTGDSREVVPGALFFALPGAVRDGHDFAAQAAARGAVAIVAERPVACAPAALLLVPSSR
RAMAVAAANFHGRPADALRVAGVTGTNGKTTVTYLVEACARAADLPVGVLGTVTQRFPGV
ERPASHTTPESTTLHAVLAEMRAAGTRAVVLEVSSHALAQERVGGMRFAAAGFTNLTRDH
LDYHGDMDAYFAAKRRLFAEHLAPDGVAVVNARDPYGARLAAQLGPGRRVWRYGTRADDT
LRAEAVSTGLAGIAATFATPAGPIAIRSPLVGAHNLENLLCAAGLALALGIAPDAVGRGL
SASAGAPGRLERIDGRGVSIFVDYAHTDDALGRALEALRALAPRRLLCVFGCGGDRDRGK
RPLMGEVAARGADLVVVTSDNPRTEAPEAIIADVLPGLERAGAARLSARAAADGARGFLV
EADRRAAIALAVSLAHPGDAVLVAGKGHEDYQLVGTTKHPFSDREEARKALGFV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgcgccgcgccgtggtgcgtgtcccggcggacacgacggcgcgtaaccgggcga
gcgcacaggggaagagattccggacggcggcttgcattccggtgcggtgacatgaagctc
tcggcggtcatccagggtacgggcgcgcggggtgaggcggcggacgatcacgagatcgtc
ctcgtcacgggcgactcgcgcgaggtcgtccccggcgcgctcttcttcgccctccccggc
gcggtgcgcgacggccacgacttcgccgcccaggccgcggcccgcggggccgtggcgatc
gtcgcggagcgcccggtcgcctgcgcccccgcggcgctcctcctcgtcccctcgtcgcgc
cgcgcgatggcggtggcggccgcgaacttccacggtcgtcccgccgacgcgctccgcgtc
gccggcgtcaccggcacgaacggcaagacgaccgtcacctacctcgtggaggcgtgcgcg
cgcgcggcggacctgcccgtcggcgtgctcggcacggtcacccagcgcttccccggcgtc
gagcgccccgccagccacaccacccccgagtccaccaccctccacgcggtcctcgccgag
atgcgcgcggccggtacgcgggcggtcgtgctcgaggtctcctcgcacgcgctcgcgcag
gagcgggtcggcgggatgcgcttcgcggcggcggggttcacgaacctcacccgcgatcac
ctcgactaccacggcgacatggacgcgtacttcgccgcgaagcgccggctcttcgccgag
cacctcgcgcccgacggcgtcgcggtggtgaacgcgcgcgatccgtacggcgcgcggctc
gcggcccagctcggaccgggccggcgcgtctggcgctacggcacccgcgcggacgacacg
ctgcgggccgaggccgtctcgacggggctcgccggcatcgcggccaccttcgcgacgccg
gcggggccgatcgcgatccgctcgccgctcgtcggcgcgcacaacctcgagaacctgctg
tgcgcggccgggctcgcgctcgcgctggggatcgcgcccgacgcagtcgggcggggcctg
tccgcctcggccggggcgcccgggcggctcgagcgcatcgacggccgaggtgtctcgatc
ttcgtggactacgcccacaccgacgacgcgctcggccgcgcgctggaggcgctccgcgcc
ctcgcgccgcggcggctcctgtgcgtgttcggctgcggcggcgatcgcgatcgcggcaag
cgcccgctgatgggcgaggtcgccgcccgcggcgccgacctcgtggtggtgacgagcgac
aacccccgcaccgaggcgcccgaggccatcatcgcggacgtcctgcccggcctcgagcgg
gcgggcgcggcgcgcctctccgcccgggccgcggccgacggcgcgcgcggcttcctcgtc
gaggccgaccgccgcgccgcgatcgccctcgcagtctccctcgcgcaccccggcgacgcc
gtgctcgtcgccggcaaggggcacgaggactaccagctcgtcggcacgacgaagcacccc
ttctccgaccgcgaggaggcccggaaggccctcggcttcgtatga

DBGET integrated database retrieval system