KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4061Help
Entry
Anae109_4061      CDS       T00559                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_4061
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Anae109_4061
   00630 Glyoxylate and dicarboxylate metabolism
    Anae109_4061
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Anae109_4061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4751033..4753342
Genome map
AA seq 769 aa AA seqDB search
MIRPDILQQFPEIFGKKQVNGREVDVEETIATLTRELRPAIAAALTARRHILANPSPARE
KYAWPSWDETFDDPVSGKRWTYRQIVQGLVDNFLGRESEWRWRLNDEVPIPDHVHPSKNP
GLELTGPWHPLDMAFNALNSPAPMNMPDFEDASPPHFTPDGTPTNQPVGVFAAMKNAKDI
HEGRWTGRPYEVVKKGKKRAYQITKPPAQWPTRLARPPSLHLRYDHVTVDGEPAPGLVVI
TTLWAFNNYDALVRAGSGVYYYIPKLQTPREALIVETLLSRLEGLMGVPAGTLKVKMLYE
EGNAGRYLPGIAWVLRRRLLGMNVGRWDYLGSMIELWKDEPEGIFPDPQSIGMATPFMIA
YQRYAALMMLMAGTKGGALTNAAPIGGMAAVMIYQPGDPYGRSAYNPVALRAITIDKLRE
RILGLMFVPDAPLAAGAQPTLAGILAGEVKGTLHDAFRQSWVASPETEYVAAGNGPLRAE
LSALQGLLDAKLETTDVKGKPVPTPASGLDAAERQLFQARGLLDAQGRITPSIVRKEELD
APEKIFSRERWEGIYAPPKGDVTIQHVQHSFYMAANYGFQILNGNFAAAIDDYELRQRFM
NDLATYRIYVSWLWTLVRHEAPITKDGHLQRQLLTEDGVVIGANAEPIRAGARFTRDLFQ
KVWDYHFEWTREFFAEQDRRGDPPRFDRSKADVIMELLKRQLLSARYVQHSARVLFVVGQ
ASAQERTPILDAIFELNRAEVVQRVRAGSMPKSALSAHDYVFDVFEGQG
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtccggacatcctccagcagttccccgagatcttcggcaagaagcaggtgaac
ggccgcgaggtcgacgtcgaggagacgatcgccacgctcacccgcgagctgcggcccgcc
atcgccgccgcgctcaccgcgcgccgccacatcctcgcgaacccgtctcccgcccgcgag
aagtacgcctggccgagctgggacgagaccttcgacgatcccgtctccgggaagcgctgg
acctaccgccagatcgtccaggggctcgtcgacaacttcctcggccgcgagagcgagtgg
cgctggcgcctcaacgacgaggtgcccatccccgaccacgtccacccctcgaagaacccg
ggcctcgagctcaccggcccgtggcacccgctcgacatggcgttcaacgccctcaactcg
ccggcgcccatgaacatgccggacttcgaggacgcctccccgccgcacttcacgcccgac
ggcacccccacgaaccagccggtgggcgtcttcgccgcgatgaagaacgcgaaggacatc
cacgaggggcgatggaccggccgcccgtacgaggtggtgaagaagggcaagaagcgcgcg
taccagatcacgaagccgcccgcgcagtggccgacgcggctggcgcgcccgccgagcctc
cacctccggtacgaccacgtcacggtggacggcgagccggcccccgggctcgtggtcatc
accaccctctgggccttcaacaactacgacgccctcgtccgcgccgggagcggcgtctac
tactacatcccgaagctccagacgccgcgcgaggcgctcatcgtcgagaccctgctctcc
cggctggaggggctcatgggcgtgccggcgggcacgctcaaggtgaagatgctgtacgag
gaggggaacgcgggccggtacctgcccggcatcgcctgggtgctgaggcggcgcctcctc
ggcatgaacgtcggccggtgggactacctgggcagcatgatcgagctctggaaggacgag
ccggaggggatcttccccgatccgcagagcatcgggatggccaccccgttcatgatcgcc
taccagcgatacgccgcgctgatgatgctcatggcgggcacgaagggcggcgcgctcacg
aacgcggcgcccatcggcgggatggcggcggtgatgatctaccagccgggcgatccctac
gggcgctccgcctacaacccggtggccctccgcgccatcaccatcgacaagctgcgcgag
cgcatcctcgggctcatgttcgtacccgacgcgccgctcgccgcaggcgcgcagcccacg
ctcgccggcatcctcgccggcgaggtgaagggcacgctccacgacgccttccggcagagc
tgggtggcgagccccgagaccgagtacgtcgccgcaggcaacggcccgctccgcgccgag
ctctccgcgctgcagggcctcctcgacgcgaagctcgagacgaccgacgtgaaggggaag
ccggtgccgacgccggcgagcggcctcgacgcggcggagcggcagctcttccaggctcgc
gggctcctcgacgcgcagggccgcatcacgccgtcgatcgtccgcaaggaggagctcgac
gcgccggagaagatcttctcgagggagcgctgggagggcatctacgcgccacccaagggc
gacgtcaccatccagcacgtgcagcactcgttctacatggccgccaactacggcttccag
atcctgaacggcaacttcgccgcggccatcgacgactacgagctccggcagcggttcatg
aacgacctcgccacctaccggatctacgtctcgtggctctggacgctcgtccgccacgag
gcgccgatcacgaaggacggtcacctccagcggcagctcctcacggaggacggcgtggtc
atcggggcgaacgcggagccgatcagggcgggcgcgcgcttcacccgggacctgttccag
aaggtctgggactaccacttcgagtggacgcgggagttcttcgccgagcaggaccgccgc
ggcgacccgccgcgcttcgaccgctccaaggccgacgtgatcatggagctgctgaagcgg
cagctgctctcggcgcgctacgtccagcacagcgcgcgcgtgctgttcgtggtcggtcag
gcgagcgcgcaggagcggaccccgatcctggacgcgatcttcgagctcaatcgcgcggag
gtggtgcagcgcgtgcgggccggctcgatgccgaagagcgccctctcggcgcacgactac
gtgttcgacgtcttcgagggtcagggctga

DBGET integrated database retrieval system