KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4215Help
Entry
Anae109_4215      CDS       T00559                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afw00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:afw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4942579..4943847
Genome map
AA seq 422 aa AA seqDB search
MDKIVIDGGVPLRGSVATSGAKNAALPIIAGALLAEGDHLVRNVPDLADVRTLGRLLVHM
GCQAERNAGEKGALWIRVPAAVQPEAPYELVKTMRASVVVLGPLVARWGKARVSLPGGCA
IGARPIDQHLKGLSALGAEIRLEHGYVEATAPRGRLRGATFTFDAQTVTGTENVMMAAAL
AEGETLLRNCAREPEIVDLAAALVRMGARISGAGADEIRIEGVETLRPLDHVVIADRIEA
GTFLAAGALPGNDVTVQGCVLEHVEALVEKLRAAGAEVLPVDGGLRVVGDGRPRPVDVRT
APHPGFPTDMQAQMMALLCLADGSSKITETVFENRFMHVQELQRLGAEIAVDGKTAVVKG
VPELSGAPVMASDLRASAALVLAGLAAQGTTEVHRVYHLDRGYERIEEKLAPLGARIRRE
KA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcgtcatcgacggaggcgtcccgctgcggggcagcgtcgcgacctccggc
gcgaagaacgcggccctccccatcatcgccggcgccctcctcgccgagggcgaccacctc
gtgcggaacgtcccggatctcgcggacgtccgcaccctcgggcggctgctcgtccacatg
ggctgccaggcggagcgcaacgccggcgagaaaggcgccctctggatcagggtccccgcc
gcggtgcagcccgaggcgccctacgagctcgtgaagacgatgcgcgcctcggtggtggtg
ctgggcccgctcgtcgcgcgctggggcaaggcgcgcgtctcgctccccggcggctgcgcc
atcggcgcgcggccgatcgaccagcacctcaagggcctctcggcgctcggcgcggagatc
aggctcgagcacggctacgtcgaggccacggcgccgcgcgggcggctccgtggcgccacc
ttcaccttcgacgcgcagacggtgacgggcaccgagaacgtgatgatggcggcggccctc
gccgagggcgagacgctgctgcgcaactgcgcgcgcgagccggagatcgtggacctggcg
gcggcgctcgtgcgcatgggggcgcgcatctcgggcgccggcgcggacgagatccggatc
gagggcgtggagacgctgcggccgctcgaccacgtggtcatcgccgaccgcatcgaggcg
ggcacgttcctcgccgcgggcgcgctccccggcaacgacgtgacggtccagggctgcgtc
ctggagcacgtcgaggcgctcgtcgagaagctgcgcgccgccggcgcggaggtgctgccg
gtggacggcgggctgcgcgtggtcggcgacggccggccgcgcccggtggacgtccgcacc
gcgccccaccccggcttcccgaccgacatgcaggcgcagatgatggcgctcctctgcctc
gccgacggctcgtcgaagatcacggagaccgtcttcgagaaccgcttcatgcacgtgcag
gagctgcagcggctcggcgccgagatcgccgtcgacgggaagaccgccgtggtgaagggc
gtccccgagctctccggcgccccggtgatggcctcggacctgcgcgcctcggcggcgctc
gtcctcgcgggcctcgcggcgcaggggacgacggaggtccatcgcgtgtaccatctcgat
cgcggctacgagcggatcgaggagaagctcgcgcccctgggcgcgcgcatccggcgggag
aaggcgtga

DBGET integrated database retrieval system