KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4215Help
Entry
Anae109_4215      CDS       T00559                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Anae109_4215
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Anae109_4215
Enzymes [BR:afw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Anae109_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4942579..4943847
Genome map
AA seq 422 aa AA seqDB search
MDKIVIDGGVPLRGSVATSGAKNAALPIIAGALLAEGDHLVRNVPDLADVRTLGRLLVHM
GCQAERNAGEKGALWIRVPAAVQPEAPYELVKTMRASVVVLGPLVARWGKARVSLPGGCA
IGARPIDQHLKGLSALGAEIRLEHGYVEATAPRGRLRGATFTFDAQTVTGTENVMMAAAL
AEGETLLRNCAREPEIVDLAAALVRMGARISGAGADEIRIEGVETLRPLDHVVIADRIEA
GTFLAAGALPGNDVTVQGCVLEHVEALVEKLRAAGAEVLPVDGGLRVVGDGRPRPVDVRT
APHPGFPTDMQAQMMALLCLADGSSKITETVFENRFMHVQELQRLGAEIAVDGKTAVVKG
VPELSGAPVMASDLRASAALVLAGLAAQGTTEVHRVYHLDRGYERIEEKLAPLGARIRRE
KA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcgtcatcgacggaggcgtcccgctgcggggcagcgtcgcgacctccggc
gcgaagaacgcggccctccccatcatcgccggcgccctcctcgccgagggcgaccacctc
gtgcggaacgtcccggatctcgcggacgtccgcaccctcgggcggctgctcgtccacatg
ggctgccaggcggagcgcaacgccggcgagaaaggcgccctctggatcagggtccccgcc
gcggtgcagcccgaggcgccctacgagctcgtgaagacgatgcgcgcctcggtggtggtg
ctgggcccgctcgtcgcgcgctggggcaaggcgcgcgtctcgctccccggcggctgcgcc
atcggcgcgcggccgatcgaccagcacctcaagggcctctcggcgctcggcgcggagatc
aggctcgagcacggctacgtcgaggccacggcgccgcgcgggcggctccgtggcgccacc
ttcaccttcgacgcgcagacggtgacgggcaccgagaacgtgatgatggcggcggccctc
gccgagggcgagacgctgctgcgcaactgcgcgcgcgagccggagatcgtggacctggcg
gcggcgctcgtgcgcatgggggcgcgcatctcgggcgccggcgcggacgagatccggatc
gagggcgtggagacgctgcggccgctcgaccacgtggtcatcgccgaccgcatcgaggcg
ggcacgttcctcgccgcgggcgcgctccccggcaacgacgtgacggtccagggctgcgtc
ctggagcacgtcgaggcgctcgtcgagaagctgcgcgccgccggcgcggaggtgctgccg
gtggacggcgggctgcgcgtggtcggcgacggccggccgcgcccggtggacgtccgcacc
gcgccccaccccggcttcccgaccgacatgcaggcgcagatgatggcgctcctctgcctc
gccgacggctcgtcgaagatcacggagaccgtcttcgagaaccgcttcatgcacgtgcag
gagctgcagcggctcggcgccgagatcgccgtcgacgggaagaccgccgtggtgaagggc
gtccccgagctctccggcgccccggtgatggcctcggacctgcgcgcctcggcggcgctc
gtcctcgcgggcctcgcggcgcaggggacgacggaggtccatcgcgtgtaccatctcgat
cgcggctacgagcggatcgaggagaagctcgcgcccctgggcgcgcgcatccggcgggag
aaggcgtga

DBGET integrated database retrieval system