KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4301Help
Entry
Anae109_4301      CDS       T00559                                 

Gene name
ligB
Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:afw03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:afw03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:afw03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:afw03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5041919..5043478)
Genome map
AA seq 519 aa AA seqDB search
MQLAELVQTSDVVARTAGRLEKIARLADALRGLAPEERLAGASWLAGELRQGRIGLGPAA
VRAALEATAPADAPALAVREVDASLDRLAAARGAGSGRERAALLAALLARASADERDFLA
RLVLGELRQGALEGVLVEAVARAAAVPAGEVRRAVMMAGALPPVAEAALAEGAAGLSRFR
LRLLEPVQPMLAQPAAGVDEALAALGEAALEWKLDGARVQVHKDGGEVRVFSRALRDVTP
AVPEVVEAVRRLPASSLVLDGEAIALRGDGAPEPFQVTMRRFGRKLDVAGLREGVPLSVL
FFDALHTAGEDLIARPASERHLALAAAVPDALRVPRLVTSDGAAAAAFLEGALARGHEGL
LAKSLTAPYEAGRRGASWLKVKRAHTLDLVVLAAEWGSGRREGFLSNLHLGARDPEGGGF
VMLGKTFKGMTDAMLAWQTERFRALALGSTDGYVVHLRPELVVEVAFDGLQESSRYPGGL
ALRFARVKRYREDKRPEEADTIATVRALHARQVAAERGT
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctcgccgagctcgtccagacctccgacgtcgtcgcgcgcaccgccgggcggctg
gagaagatcgcgcggctcgccgacgccttgcgggggctcgcgcccgaggagcggctcgcc
ggggcgagctggctcgccggcgagctgcgccagggcaggatcggcctcgggcccgccgcg
gtgcgggcggcgctggaggcgaccgccccggcggacgcgcccgcgctcgcggtgcgcgag
gtggacgcctcgctcgaccgcctcgccgcggcgcgtggcgcgggctccggacgcgagcgg
gcggcgctgctcgcggcgctgctcgcccgcgcctcggcggacgagcgcgacttcctcgcg
cggctcgtgctcggggagctccgccagggcgccctcgagggcgtgctcgtcgaggcggtg
gcgcgcgcggcggccgtcccggcgggggaggttcgccgcgccgtgatgatggccggcgcg
ctccccccggtggcggaggcggcgctcgccgagggcgcggcgggcctctcccgcttccgg
ctgcggctgctggagccggtgcagccgatgctcgcgcagccggcggccggcgtggacgag
gcgctcgccgcgctcggcgaggccgcgctggagtggaagctcgacggcgcccgcgttcag
gtccacaaggacggcggcgaggtgcgggtgttctcgcgcgcgctccgggacgtgacgccg
gccgtcccggaggtggtcgaggccgtccggcgcctgcccgcgtcctcgctggtgctggac
ggagaggccatcgcgctgcgcggggacggcgctcccgagccgttccaggtgacgatgcgc
cgcttcggccgcaagctcgacgtggcgggcctgcgcgagggggtgccgctctcggtgctg
ttcttcgacgcgctccacacggccggggaggatctcatcgcgcggcccgcctccgagcgc
cacctcgcgctcgccgccgcggtccccgacgcgctccgcgtgccccggctcgtcacctcc
gacggcgccgccgcggcggccttcctcgagggcgcgctcgcgcgcggccacgaggggctc
ctcgcgaagtcgctcacggcgccctacgaggcgggccggcgcggggcgagctggctcaag
gtgaagcgcgcgcacaccctggacctcgtggtgctcgccgcggagtgggggagcggccgc
cgcgaggggttcctgtcgaacctgcacctcggcgcccgcgatccggaggggggcgggttc
gtcatgctcggcaagacgttcaagggcatgaccgacgcgatgctcgcctggcagaccgag
cgcttccgcgcgctcgcgctcggctcgaccgacggctacgtcgtgcacctccggccggag
ctcgtggtggaggtcgccttcgacggcctccaggagagctcgcgctatccaggcggcctc
gcgctgcggttcgcgcgggtgaagcgttaccgcgaggacaagcggccggaggaggcggac
accatcgcgacggtgcgggcgctgcacgctcgtcaggtggcggcggagcgcgggacgtga

DBGET integrated database retrieval system