KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_4419Help
Entry
Anae109_4419      CDS       T00559                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afw00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:afw00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5169386..5170483)
Genome map
AA seq 365 aa AA seqDB search
MPVSTLDRDVAGLFCVGFHGKTPSPEVLELIRRGVYGVILFGRNVESAEQVAELVAALKG
AAGRPLLVSIDQEGGRVARLREPQGFTELPPMRAVGDAGDEGLAREVGALLGRELRAVGV
DQDYAPIVDVDTNPANPVIGDRAFSRDPETVARLGAALAAGLQSEGVAACAKHFPGHGDT
SQDSHKDLPRLPHPLARLEEVELLPFRALARAGVASMMTAHVVFEALDPRRPATLSPEVM
RLLRERVGFQGCAISDDLEMKAVAEHFPLEEAAPGAVTAGVDAILVCHTTALQHRAIDLV
RAAVEDGRIPRARLEEARARVARLLSYAGPAPDPRELRARLRSRAHLATAARIPRITTGN
DPTVA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtctccacgctcgatcgcgacgtcgccggcctgttctgcgtcggcttccacggc
aagaccccgtccccggaggtgctggagctgatccggcgcggcgtgtacggcgtcatcctg
ttcgggcgcaacgtggagagcgcggagcaggtggcggagctcgtcgccgccctgaagggc
gcggcgggccgccccctcctcgtctccatcgatcaggagggcggccgggtggcccgcctg
cgcgagccgcaggggttcaccgagctgccgccgatgcgggcggtgggggacgcgggggac
gaggggctcgcgcgcgaggtgggcgcgctgctgggccgcgagctgcgcgcggtcggcgtg
gaccaggactacgcgcccatcgtggacgtggacacgaacccggcgaatccggtcatcggc
gatcgcgccttctcgcgcgaccccgagaccgtggcgcgcctcggcgccgcgctcgcggcg
gggctgcagtccgagggcgtcgccgcctgcgcgaagcacttccccggccacggcgacacg
agccaggactcgcacaaggacctgccgcgcctgccccacccgctcgcgcggctcgaggag
gtggagctgctgccgttccgggcgctcgcgcgcgcgggcgtggcctcgatgatgaccgcg
cacgtggtgttcgaggcgctcgacccgcgccggccggcgacgctctcacccgaggtgatg
cggctcctgcgcgagcgcgtgggcttccagggctgcgcgatctccgacgacctcgagatg
aaggccgtcgccgagcacttcccgctggaggaggccgcgcccggcgcggtcacggccggc
gtggacgccatcctcgtctgccacaccaccgccctgcagcaccgcgccatcgacctggtg
cgcgcggcggtcgaggacggccgcatcccgcgcgcgcggctggaggaggcccgggcgcgc
gtcgcgcggctcctctcctacgccgggcccgcccccgatccgcgcgagctccgcgcccgg
ctccgctcgcgcgcgcacctcgccaccgccgcgcgcatcccgcggatcaccacggggaac
gatccgacggtcgcgtag

DBGET integrated database retrieval system