KEGG   Addendum: AAB71084Help
Entry
AAB71084          CDS       T10000                                 

Gene name
ag2
Definition
(KEGG) myrcene synthase (EC:4.2.3.15)
  KO
K12467  
myrcene/ocimene synthase [EC:4.2.3.15]
Taxonomy
TAX:46611
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinidae; Pinales; Pinaceae; Abies
Organism
ag  Addendum (Abies grandis)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GB: 
UniProt: 
AA seq 627 aa AA seqDB search
MALVSISPLASKSCLRKSLISSIHEHKPPYRTIPNLGMRRRGKSVTPSMSISLATAAPDD
GVQRRIGDYHSNIWDDDFIQSLSTPYGEPSYQERAERLIVEVKKIFNSMYLDDGRLMSSF
NDLMQRLWIVDSVERLGIARHFKNEITSALDYVFRYWEENGIGCGRDSIVTDLNSTALGF
RTLRLHGYTVSPEVLKAFQDQNGQFVCSPGQTEGEIRSVLNLYRASLIAFPGEKVMEEAE
IFSTRYLKEALQKIPVSALSQEIKFVMEYGWHTNLPRLEARNYIDTLEKDTSAWLNKNAG
KKLLELAKLEFNIFNSLQQKELQYLLRWWKESDLPKLTFARHRHVEFYTLASCIAIDPKH
SAFRLGFAKMCHLVTVLDDIYDTFGTIDELELFTSAIKRWNSSEIEHLPEYMKCVYMVVF
ETVNELTREAEKTQGRNTLNYVRKAWEAYFDSYMEEAKWISNGYLPMFEEYHENGKVSSA
YRVATLQPILTLNAWLPDYILKGIDFPSRFNDLASSFLRLRGDTRCYKADRDRGEEASCI
SCYMKDNPGSTEEDALNHINAMVNDIIKELNWELLRSNDNIPMLAKKHAFDITRALHHLY
IYRDGFSVANKETKKLVMETLLESMLF
Reference
PMID:9268308
  Authors
Bohlmann J, Steele CL, Croteau R
  Title
Monoterpene synthases from grand fir (Abies grandis). cDNA isolation, characterization, and functional expression of myrcene synthase, (-)-(4S)-limonene synthase, and (-)-(1S,5S)-pinene synthase.
  Journal
J Biol Chem 272:21784-92 (1997)
DOI:10.1074/jbc.272.35.21784

DBGET integrated database retrieval system