KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000018Help
Entry
AgaP_AGAP000018   CDS       T01036                                 

Definition
AGAP000018-PA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aga00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:aga04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aga04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aga04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aga04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 1133 aa AA seqDB search
MKRNTTTMPGGTDSSWSVPHRIYLQQQQQQQQQQQQQAHQQQQQQQQQQRPRFDYGFWKN
PDESTELIFLMPNGVMITMYIPIHITLDELKSDVWEEAERYPLYCHLGDKNKYCFGTLAA
GRTNSNTTYENEAETRLMDVQPTLGILRFVEKSNVSENTKLMENISSLLDSKLPVKTLVN
PEVNDFRAKMSMLSEDIGSRRAVMTRMERIAYQYPAKLVSGAHVPEPISRRLTNGDFCVV
AISTDMQLTVKVPCRATPDEVLKRILKKQNPSKARNENSSTEYILKVCGREEYIYGAHPM
ISFQYVQDCLSRDETPTFVPRLVRTVEVFKNDIYDAREDFTQWSASAKPSSLYGGSISSS
SGYAGSAGSTYNTQSQQSHTLRKVKYITSWEIDAKLQCTVHEIRGLNVESDKELGVQLGL
FHGGKSLCKTERTRTVTVNSGAATWNETILFDINVSNVPRMARLCLVVYENMRTAKGTGI
RTRRTKDGLINPIAWVNTMVYDYKNQLKVDSVTLYTWDYAEDAQSEDILHPLGTVEPNPN
RDNMVVSVLLSFGTYGPEGRIIVYPGEEELLSHAAKMSHRNEHLNRESAEDTRSIRAIMS
AYMYNDRLNDIHEQDRNAIWAKRRECMKQMPQGLPCLLYCVEWNNRDEVSEIVSLLQEWP
KLLVERALELLDYAYADKYVRRYAVDCLRTIEDDELLLYLLQLVQALKHESYLNCDLVYF
LLQRALHNQHIGHYLFWHLRSEISVPSVQVRFGLILEAYLLGSPEHVAVLLKQMQCLRYL
QTCSDNVKKGSKEKGRTLLIEQLAKEGHVTSDLISPLNPSYRCKAVRTDRCKVMDSKMRP
LWIVYENSDANGDDIHMIFKNGDDLRQDMLTLQMLRIMDRIWKSHGYDFRMNPYSCISTD
HKLGLIEVVLNAETIANIQKERGMFSATSPFKKGSLLAWLREHNGTEDLLAKAIQEFTLS
CAGYCVATYVLGVADRHSDNIMVKKTGQLFHIDFGHILGHFKEKFGFRRERVPFVLTHDF
VYVINNGRTDREAQEFCRFQTLCEEVRAYGKAFLILRQHGCLILSLFSMMISTGLPELSS
EKDLNYLRETLVLDKTEEEARTHFKLKFSEALANSWKTSLNWASHNFSKNNRQ
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaacactaccacgatgccggggggaaccgattctagctggtccgttccacac
cggatttatctgcagcagcagcagcagcagcagcagcaacagcagcagcaggcccaccag
cagcagcaacagcagcagcaacagcagcgaccacggtttgattacggattctggaagaat
ccggacgagtcaaccgaactgatcttcctgatgccgaacggcgtgatgatcacgatgtac
ataccgatccatattacactggatgaactgaagtcggacgtttgggaggaggcagaacgg
tacccactgtactgccatctaggcgataagaacaagtactgcttcggcaccctggcggcg
ggccggacgaacagcaacacgacgtacgaaaatgaggccgaaacccggctgatggacgtg
cagcccactctcggcatcctgcgcttcgtcgagaagagcaacgtgtcggagaacacgaag
ctgatggagaacattagcagcctgctggacagcaagttgccggtgaagacgctggtcaac
ccggaggtgaacgatttccgcgccaagatgagcatgctgagcgaggatatcggcagccgg
cgggccgtaatgacgcggatggagcggatagcctaccagtacccggccaagctggtcagc
ggtgctcacgtgcccgagccgatcagccggcggctgacgaacggcgacttttgcgtggtg
gcgatcagcaccgacatgcagctgacggtgaaggtaccgtgccgggcgactccggacgag
gtcctgaaacgcatcctcaagaagcagaacccgtcgaaggcgcgcaatgagaacagtagt
acggagtacatattgaaggtgtgcgggcgggaagagtacatctatggggcgcacccgatg
atcagcttccagtacgtgcaggactgtctgtcgcgggacgagacgcccacgtttgtgccg
cggctcgtccgcacggtggaggtgtttaagaacgacatctacgacgcgcgcgaagacttt
acgcagtggtcggcgtcggccaagccgagctcgctgtacggcggcagcatcagcagcagc
agcgggtacgccggtagcgcaggcagtacctacaacacccagtcgcagcagtcgcacacg
ctgcgaaaggtgaagtacatcaccagctgggagatcgacgcgaagctgcagtgcacggtg
cacgagattcgcgggctgaatgtcgagtcggacaaggagctgggcgtgcagctcggtctg
tttcacggcggcaagtcgctgtgcaaaacggagcgcacgcgcacggtcacggtgaacagt
ggcgccgcgacctggaacgagacgatcctgttcgacatcaacgtaagcaacgtgccgcgc
atggcgcggctgtgcctggtggtgtacgagaacatgcgcacggccaaggggacgggcata
cggacgcgccgcaccaaggacgggctgatcaatccgatcgcgtgggtcaacacgatggtg
tacgactacaagaaccagctgaaggtggactcggtgacgctgtacacgtgggactacgcg
gaggatgcgcagtcggaggacattttgcatccgctcggcacggtcgagccgaacccgaac
cgggacaacatggtcgtgtcggtgctgctgagcttcgggacgtacggtccggaggggcgc
atcatcgtctacccgggcgaagaggagctgctgtcgcacgcggccaagatgagccaccgc
aacgagcatctgaatcgcgagagcgccgaggacacgcgctcgatccgggcgatcatgtcg
gcgtacatgtacaacgaccggctgaacgacatccacgagcaggaccgtaacgcgatctgg
gcgaagcggcgcgagtgcatgaagcagatgccgcaggggctgccctgtctgctctactgc
gtcgagtggaacaaccgagacgaggtgtccgagatcgtgtcgctgctgcaggagtggccc
aagctgctggtcgagcgggccctcgagctgctcgattacgcgtacgcggacaagtacgtg
cgccggtacgccgtggactgtctgcgcacgatcgaggacgacgagctgctgctgtacttg
ctccagctggtgcaggcgctcaagcacgagtcgtacctgaactgcgatctggtgtacttt
ctgcttcagcgcgccctgcacaaccagcacatcggccactatctgttctggcatctgcgt
tccgagatttcggtgccgtcggtgcaggtccggttcgggctgatactggaggcgtacctg
ctcggcagcccggagcatgtggctgtgctgctgaagcagatgcagtgcctgcgctacctg
caaacctgctcggacaacgtgaagaagggcagcaaggagaagggccgcacgctgctgatc
gagcagctcgccaaggagggccacgtgaccagcgacctgatcagcccgctcaacccgagc
taccggtgcaaggcggtccggaccgaccggtgcaaggtgatggactcgaagatgcgcccg
ctctggatcgtgtacgagaacagcgacgcgaacggcgacgacatacacatgatcttcaag
aacggggacgacctgcggcaggatatgctgacgctgcagatgctgcgcatcatggaccgg
atctggaagagccacgggtacgacttccggatgaacccgtacagctgcatcagcaccgac
cacaagctcggcctgatcgaggtggtgctgaacgcggaaacgatcgcgaacatccagaag
gagcgaggcatgttttcggccacttcgccgttcaagaagggttcgctgctggcgtggctg
cgcgagcacaacggcaccgaggacctgctggcgaaggcgatccaggagtttacgctcagc
tgcgccggctactgcgtggcgacgtacgtgctgggggtggcggaccgccactccgacaac
attatggtgaagaagacgggccagctgtttcacatcgacttcgggcacatactgggccac
ttcaaggagaagtttggcttccggcgggagcgcgtgccgttcgtgctgacgcacgatttc
gtgtacgtgatcaacaacggccggacggatcgggaggcgcaggagttctgtcgcttccag
acgctctgcgaagaggtgcgtgcgtacgggaaggcgttccttattctacgccagcacggc
tgcctgatactgtcgctgttctcgatgatgatctcaactggcctcccggagctgtcgtcc
gaaaaggatttaaactatctgcgggaaacgctggtgctggacaaaacggaagaagaggcg
cgtacccacttcaagctcaagttcagtgaagcgcttgccaactcgtggaaaacgtcgctc
aactgggcatcgcacaacttctccaaaaacaatcgacagtga

DBGET integrated database retrieval system