KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000065Help
Entry
AgaP_AGAP000065   CDS       T01036                                 

Definition
AGAP000065-PA
Orthology
K15293  
protein unc-13
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 2275 aa AA seqDB search
MDENEVMAAFLWSKQSQEMYSNQGLKDLHHLHQDFIINDYTDKIATNIDLLDTELKFAWA
ALNLLNEEYTKMSEKVFKLQSLNISQQRIVQNLQFMEENRKAYLDMIPDYAKHHEFSLQE
QSRLRKDLEYRDRINEALINSGMIPLQEEREEFLHQQQQLQLQHQHQHQQHQQQLFHHQL
QSSAQMYHASAQLQAGRHGLYEGMQLLDQHLQQQQQQQQQHQQQQHQQQQQVQLQFENDF
LILQRNLANVPPEVLKVEHGQGILQPHLEPAAAPLPSGSAAAAPHPPLPRMSTNPFLSAG
EADRGLLRNIEPADSAAIIEEQLRTSFLNHAKQIELEFGTPKSKQYTAERIEKMQSEEVR
ELINKIMSEEDVASLSSEEMDRVRCFMAKNCTELMDVFDDDLQVVYPVKSAELLMARGKQ
AVATAATAAGPSPRKELAKYLSDGLATLTKDDLLTVENGTITIQDSASENDFRLNLSTDA
SRLPEHGASPKKLSEFSPFGLQATAAAATILGTDAVYDGFREVRALEAEQRMEAASKAEE
KLQYSAGGAATREADAVDVPKTTIPPTFACSNLVGLTSGKPLFAGSLRPNITEALEMTSC
VTASSVLAPQHAHGVETVDVRQAGPGICAEGVTLPPRKASVVDAACLVSAPAKTTAVTEA
TDTAAILQAIISRRSSVAEPSTSPPTFQPLPGQTSITDSPEMQAIYDSLSRKSSLPTLSD
TNFFPSLDITDSGFADTSDSLALFAQLPLTVPGTEAPISLPDFSTMSAISNMPDSSDCSS
FLHMSMNSSGISEASDGMGGFASHPVPIAAGEQLQHCKDALVITSTTLVTTTSTTTVGKL
PALPPIGPTTTTMAALAEGKPIVEATGLALPALVAATVTGTTVVTSTIVTANGTATVHGP
ASAVVTMPPTTADATKSVKPPPTTTGTPFVKPAAAVPASGAVQPQPTGQPTASQQSKVPL
VGALLPSKQPAAPAAQPPPQPPTEQKGAAGGGFFQSTTVNIGSFFNKVNKNLVHQESSDS
IIGAKSKSFFASMKSSFSIDSSKASVDEGDGQQVASAQPPAGQLDVAQLQQQTSADLSPL
AAKGGTTPSAEGSLHEQHTPSSLSGEQQSSPPRDTSSFEGQLDPSPVGTQQSPLAEYDPE
DQYQAYDQQDPGSATDSQHQPGDGQLDRELDPNGNGAAPAAQRRQSLFRAQGSEDGEGGS
KWKLLKTLKEKRIEEKQKVVEVGESFDDEPGLFKKVDVSGKTEEPEKRNGTVDSGRNNGL
GDNTFYSNIDSMPDIRPRRKSIPLVSELTMAATKRNAGLTSAVPRATLNDEELKMHVYKK
ALQALIYPISSTTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECAVKCHEKCKDLL
NADLCFAGASEKSSKHGAEDKANSVIAAMKERMKQRERDRPEIFELIRKVFAVEEKSHAG
HMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQE
LNPVWNEKFNFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGE
MDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENVFHYLCEEALGAV
NLPQTKGDDGWKIYFDETPEEIVDEFAMRYGIENIYQAMTHFHCLSTKYLCAGVPAVMST
LLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASS
QEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFFSEHALFSN
SVVDVFTQLTQCFDVVSKLDCPDPEIWKRYMRRFAKTIVKVLLAYVDIVKSEFPDIMHEE
RTACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNTALDDLATQFAKSLE
PRITGSVRELGDLLQQVKQQSSLFHAPPADDANLIAIEADEVLRPLMDLLDGSLSMYAQS
CEKTVLKRLLKELWKIVIRTLEKTIVLPPMTDRTMVFKHLTDNAKNLAANAKIEDMSRLI
KNHMSGKQDAKNVLSGVMDISKEMEKNLSPKQCAVLEVALGTIQQYFHAGGNGLKMPFLE
KSPELQSLKYALSLYTQTTDTLIKSFVSGQGASEEGVSHDDASVGEVSIQIDVSSNPENG
EQKISVKVIAANDLKWTVPSGMFRPFIEVNLIGPHLNDRKRKFATKSKSNNWSPKYNDTF
HFIIGNEEQLEFFELHICVKDYCFAREDRLVGVAILKLKDVVDQVYYWVIYLICV
NT seq 6828 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaacgaggtgatggccgcgttcctgtggagcaagcagtcgcaggagatgtac
agcaaccaggggctgaaggacctgcaccacctgcaccaggactttatcatcaacgactac
accgacaagatagcgaccaacatcgacctgctcgacacggagctcaagtttgcctgggcg
gcgctgaacctgttgaacgaggagtacaccaagatgtcggagaaggtgttcaagctgcag
tcgctcaacatctcgcagcagcggatagtgcagaatctgcagtttatggaggagaaccgg
aaggcgtacctcgacatgataccggactacgcgaagcatcacgagttttcgctgcaggag
cagtcgcggctgcggaaggatctggagtaccgggatcggatcaacgaggcgctcattaac
agcggcatgataccgctgcaggaggagcgggaagagtttctgcaccagcagcagcagctg
cagctgcagcaccagcaccagcaccagcagcaccagcagcagctcttccaccatcagctg
cagagctcggctcagatgtaccacgcgagtgcgcagctccaggcaggcaggcacgggctg
tacgaaggtatgcagctgctcgatcaacacctgcagcagcagcagcagcagcagcagcag
caccaacaacagcagcaccagcaacagcagcaggttcagctgcagtttgaaaacgatttt
ctcatcctgcagcgcaatctagcgaatgtgccgccggaagtgttgaaggtggagcacggg
cagggcatactgcagccgcatctggagccggccgccgccccgttaccttctggcagtgcg
gccgccgccccccatccgccgctgccgcgcatgtcgaccaatccgttcctgtcggcgggc
gaggcagaccggggcctgctgcgcaacatcgagccggcggacagtgcggccatcatcgag
gagcagctgcgcacctccttcctgaaccacgcgaagcagatcgagctcgagttcggcacg
cccaagtcgaagcagtacacggcggagcggatcgagaagatgcagagcgaggaggtgcgg
gagctcatcaacaagatcatgagcgaggaggacgtggcgtcgctcagcagcgaggagatg
gaccgggtgcgctgcttcatggcgaagaactgcaccgagctgatggacgtgttcgacgac
gacctgcaggtggtctacccggtcaagtcggccgagctgctgatggcgcggggcaagcag
gccgtcgccaccgccgccaccgccgccggtccgagtccgcgcaaggagctggccaagtat
ctgtcggacgggctggccacgctaacgaaggacgatctgctgacggtggagaatgggacg
ataacgatacaggacagtgcgtcggagaacgatttccggctgaatctgagcacggacgcg
agccgactgcccgagcacggtgcctcaccgaagaagctgagcgagttctcgcccttcggc
ctgcaggcgactgctgccgcggccaccatcttggggacggacgccgtgtacgacggattt
cgggaggtgcgggccttggaggcagagcagcgcatggaggccgcttcaaaggccgaagag
aagctgcagtacagtgcggggggcgcagcaacccgggaagcggacgcggtggacgtgccg
aaaacgaccattccgcccacgttcgcctgctccaacctggtgggcctgaccagcggcaag
cctctgttcgcgggaagcctgcggccgaacatcacggaagcgctcgagatgacgtcttgc
gtcactgcctcaagcgtcctcgcgccgcaacacgcccacggcgtcgaaacggtcgatgtt
cgccaggccgggccaggcatttgtgcggagggcgtcacgctgcccccgcgcaaggctagc
gtagtggacgccgcgtgcctggtgtcggcaccggccaagaccactgccgtcaccgaggcg
accgacacggccgccatcctgcaggccatcatcagccgccggtcgagcgtggcagaaccg
tccaccagtccgcccacgtttcagccgctgcccggccagacctccattaccgactcgccc
gagatgcaggccatctacgacagcctgtcgcgcaagtcgagcctgccgacgctcagcgat
accaacttcttcccctcgctggacattaccgactcgggctttgccgatacgagcgacagc
ctggcgctgttcgcgcagctgccgctcaccgtgcccggcacggaggcaccgatcagcctg
ccggacttctccaccatgtccgcgatctcgaacatgccggacagctcggactgctcctcc
tttctgcacatgtcgatgaactcgtccggcattagcgaggcgtcggacgggatgggcggc
ttcgccagccatcccgtgccgatcgcggccggcgagcagctgcagcactgcaaggacgcg
ctggtcatcacgtccaccacgctggtgacgaccacctccaccacgacggtgggcaaactg
cccgccctgccaccgatcggccccaccaccaccacgatggccgccctggccgagggcaaa
ccgatagtggaggcgacgggactggcactgccagcgctggtcgcagccacggtgacgggc
acgaccgtcgtcaccagcaccatcgtcactgccaacgggacggcgaccgtgcatgggccg
gccagtgcggtagtcaccatgccgcccactaccgcagatgcaacgaagagtgtgaagccg
ccaccgaccacaaccggcacgccctttgtgaagccagcagctgcagtacccgcgagtggg
gcggtccaaccgcaacccaccggccaaccgacagccagtcagcagagcaaggtaccgctg
gtaggcgcactgctgccctcgaagcaaccagctgccccggcggctcaaccaccgccacaa
ccaccgaccgagcagaagggtgcggccgggggcggcttcttccagtcgaccaccgtcaac
atcggcagcttcttcaacaaggtcaacaagaacctggtgcatcaggaaagctcggacagc
atcatcggcgccaagtccaagtccttctttgcctcgatgaagagctccttcagcatcgac
tcgtccaaggcgtccgtggatgagggggacgggcagcaggtggccagcgcacagccacct
gccggccagctggacgtcgcgcagctgcagcagcagacgtcggcagatctgtccccgctc
gctgccaaaggtggtacgacaccgtctgccgagggttcgctgcacgagcagcacactccc
tcgtcgctgtcgggcgagcagcagtcgtcgccgccgcgcgacacctcctccttcgagggt
cagctcgacccgagcccggtcggtacgcagcagagcccgctggcggagtacgacccggag
gaccagtaccaggcgtacgaccagcaggacccgggcagtgccaccgacagccagcatcag
ccgggcgacggccagctggaccgcgagctcgacccgaacggtaacggggcagcgccggcg
gcccagcgtcgccagagcttgtttcgcgcccaaggtagtgaagatggcgagggcggcagc
aaatggaagctgctgaagacgctcaaggagaagcgtatcgaggagaaacagaaagtggtc
gaagtcggtgagtccttcgacgacgagcccggtctgttcaaaaaggtggacgtaagtggc
aagaccgaggagcccgagaagcgcaatgggacggtcgacagtggacggaacaatgggctt
ggtgacaacacgttctacagcaacatcgacagcatgcccgacattcgaccaaggaggaag
tccataccgcttgtgtcggagctgaccatggctgccacgaaacggaatgctggactgacc
tcggccgtaccgcgagcgaccctaaacgatgaggagctgaaaatgcacgtatacaagaag
gcgctgcaggcgttgatctatcccatctcgtcgaccacaccccacaacttcgtcctgtgg
acggccacctccccgacctactgctacgagtgcgaggggctgctctggggtattgcgcga
cagggtgtcaggtgtacggagtgtgctgtcaagtgtcacgaaaagtgcaaggacttgctg
aacgcagacttgtgctttgccggtgcttccgaaaagagctccaaacacggggccgaggat
aaggcgaactcggtgatagcggccatgaaggagcgcatgaagcagcgcgaacgcgaccgg
ccagaaatattcgagctgatcaggaaagtgtttgcggtggaggagaagagccacgccggc
cacatgaaggcggtgaagcagagcgtgctggacggtacgagcaagtggtcggccaagatc
gccatcaccgtcatctgtgcgcagggtctgatcgcgaaggacaagagcggcaccagcgat
ccgtacgtgacggtgcaggtaagtaaggtgaagaagcgcacccgcacgatgccgcaggag
ctgaacccggtgtggaacgaaaagttcaacttcgagtgccacaactcgtccgatcgcatc
aaggtacgcgtgtgggacgaggacaacgatctgaaatcaaaactgcgccagaagctgacg
cgagagtcggacgactttctgggacagacaatcattgaagtgcgaacgctgtcgggcgag
atggacgtttggtacaatctggagaagcgtactgacaaatcagccgtgtccggggcgatc
cgcttgcatatttccgtagagatcaaaggcgaggaaaaggtagcgccgtaccacgtccag
tacacctgcctgcacgagaacgtgtttcactacttgtgcgaggaggcgctgggagcggtg
aatcttccccagaccaagggtgacgacgggtggaagatttacttcgacgaaacgcccgaa
gagatcgtggacgagttcgcgatgcgctatggcatcgagaacatctaccaagccatgacc
cactttcattgcctatctacgaagtacctgtgcgctggcgtcccggctgttatgagtaca
ctattagctaatataaacgcttactatgcacacactacggcttcgagcgcggtatcggcc
agcgatcgctttgcggcaagcaattttggtaaagaaaagttcgttaagctactggaccag
ctgcacaactcgttacgaatcgacttgtccatgtatagaaataacttccccgcttccagt
caggagaagctgatggatctaaaatctaccgtagatttgttaaccagtattacctttttc
cgtatgaaagttcaagagttatccagcccacctagagcgagcacagtggtgaaggattgt
gttaaggcttgtctgcgatcaacctaccaattttttagtgagcatgctctcttctcaaac
tcggtcgtcgatgtctttacgcagctaacacagtgcttcgatgtggtaagcaaactcgac
tgtcccgatccagaaatctggaagcgttacatgcgacgttttgctaagaccattgttaaa
gtactgcttgcgtatgttgatatcgtaaagtcggagttccccgatataatgcatgaggag
cgaacagcgtgcattcttatgaacaacatccagcaactgcgggtgcagctggagaagatg
ttcgagtcgatgggcggcgataagctggaagaggatgcggccaacattctcaaagaactg
cagcagaacctgaacacggccctggacgacctggcgacacagttcgcaaagagcttggag
cctagaattactggcagcgtgcgggagctgggcgatctgctgcagcaggtgaagcagcag
agctccctgttccatgcgccaccggccgacgatgccaacctgatcgcgatcgaggcggac
gaggtgctgcgaccgctgatggacctgctggacggttcgctctcaatgtacgcccagtcc
tgcgagaagaccgttttgaaaagactgctgaaggagctgtggaagatagtgatccgaacg
ctggagaaaacgatcgtgcttccaccgatgacggatcgaacgatggtgttcaagcatctc
accgacaatgccaaaaatctggcagcgaatgcgaaaatcgaggacatgtcccgactcatc
aagaaccacatgtccggcaagcaggatgccaagaacgtgctcagcggggtgatggacatc
tccaaggagatggagaagaacctatcgcccaagcagtgcgccgtgctggaagttgcactc
ggcacgatccagcagtacttccacgccggcggcaatgggctgaagatgccgttcctggag
aagtcgccggagctgcagagcttgaagtacgcgctcagcctgtacacgcagaccacggac
acgcttatcaaatcgttcgtctccgggcaaggtgcttcggaagaaggggttagtcacgat
gatgcttccgtcggtgaggtgtccattcagatagacgtctcgtcgaacccggagaacgga
gagcagaaaatatccgtcaaggtgatcgctgccaacgatctcaaatggaccgtcccgtcc
ggcatgttccggccattcatcgaggtcaatctgatcggaccgcatctgaacgataggaaa
cgaaagttcgcgaccaaatcgaaatcgaacaactggtcgccgaagtacaatgacaccttc
catttcattattggcaacgaggagcagctggaatttttcgaactgcacatatgcgtgaag
gattactgcttcgcccgggaggatcggctggttggtgtagcaatactaaagctgaaagat
gtcgttgatcaggtatactattgggtgatatatttaatttgtgtgtga

DBGET integrated database retrieval system