KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000180Help
Entry
AgaP_AGAP000180   CDS       T01036                                 

Definition
AGAP000180-PA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP000180
Enzymes [BR:aga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     AgaP_AGAP000180
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     AgaP_AGAP000180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 427 aa AA seqDB search
MATVTEVGGIKTGKLLIEGKTKQVYDVPSMPGHSILLNKDRITAHNGVRAHDLEGKAKIS
NQTNAKVFTLLNRAGLKTAFVRMISDNAFLARKCDMVPIEWVTRRVATGSYLKRNPGVKE
GYRFAPAKVETFFKDDANDDPQWSEEQIVCAGFKVNGVTIGQDEVDIMRQTTALVFEVLE
RAWATRNCALIDMKIEFGVDADGQLLVADVIDSDSWRLWPAGDKRMMVDKQVYRNLANVT
AADLDVVKRNFTWVSDELDKMDAPASHLVVILMGSASDKEHCEKIAKHCAALGLNAELRV
TSAHKGTQTTLHMVSEYESVLSELVFITVAGRSNGLGPVLSGNTNYPVINCPPVKPENVE
QDVWSSLNLPSGLGCATVLYPEAAALHAAQILGMKNFLIWSKLRVKQLHNFASLIMADKK
MRGVRSN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgttacggaagttggaggcatcaagaccggcaagctgctgatcgagggcaag
acgaagcaggtgtacgatgtgccgagcatgccgggccactcgatcctgctgaacaaggat
cgcatcaccgcccacaacggtgtgcgggcgcacgatctcgagggtaaggcgaagatctcc
aatcaaacgaacgcgaaagtgttcacgctgctgaaccgggccggtctgaagaccgcgttc
gtgcgcatgatctccgacaacgcgttcctcgcgcgcaagtgcgacatggtgccgatcgag
tgggtgacgcgccgggtcgcgaccggttcgtacctgaagcgcaacccgggcgtgaaggag
ggctaccgctttgcgccggccaaggtcgagacgttcttcaaggacgacgcgaacgacgat
ccgcagtggagcgaggagcagattgtgtgcgccggcttcaaggtgaacggtgtgacgatc
ggccaggacgaggtggacattatgcgccagacgaccgcgctcgtgttcgaggtgctggag
cgggcctgggccacccgcaactgtgcgctgatcgacatgaagattgagttcggcgtcgac
gcggacgggcagctgctggtggcggacgtgatcgattccgactcgtggcgcctctggccg
gcgggcgacaagcgcatgatggtggacaagcaggtgtaccgcaatctggcgaacgtgacg
gccgccgatctcgacgtggtcaagcgcaactttacctgggtcagcgacgagctggacaag
atggatgcaccggccagccacctggtggtcatactgatggggtccgcctcggacaaggag
cactgcgagaagatcgccaagcactgtgccgcgctcgggctgaacgcggagctgcgcgtg
acgtccgcgcacaagggcacgcagacgacgctgcacatggtgagcgagtacgagagcgtg
ctgagcgagctggtgttcatcacggtggcgggccggtcgaacgggctcggcccggtactg
tccggcaacaccaactatcccgtcatcaactgcccgccggtcaagccggaaaatgtcgag
caggacgtgtggtcgagcctgaacctgccgtccgggctgggctgtgcgaccgtcctgtac
ccggaggcggccgccctccacgccgcccagatactgggcatgaagaacttcctcatctgg
agcaagctgcgcgtgaagcagctgcacaactttgccagcctgatcatggcggacaaaaag
atgcgcggcgtacgctctaactaa

DBGET integrated database retrieval system