KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000269Help
Entry
AgaP_AGAP000269   CDS       T01036                                 

Definition
(RefSeq) AGAP000269-PA
  KO
K11851  ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:aga00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    AgaP_AGAP000269
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP000269
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP000269
Membrane trafficking [BR:aga04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AgaP_AGAP000269
Ubiquitin system [BR:aga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AgaP_AGAP000269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 1271988
NCBI-ProteinID: XP_310850
VectorBase: AGAP000269
UniProt: Q7QF25
Position
X
AA seq 568 aa AA seqDB search
MESEKLLMAAGVTAAVVVGAFVFWGPSGSSKLRQRRGQIAGLHNFGKTCFLNTLLQALAA
CPQFIAWLQLHNTKDKKSLVSSLQNVLEVVNGTHPTLRGDPYAPGAVIRALHALGWVISP
EEHDAHELLLVMLSSLEEEVSKPRKIGCLSDALDDVVGGGGGGGGDLGFHAIPARPSSAM
LSDFCNAEYDESTSLMRYTRSEAHTPDSPHSVCTENEEQSQESSLVEFGASPSHAISVAF
GGRRFGSRMQLQQQQQQTMVRPTPMGRDEQTSVGMGDAGGNHFAGKRHSASYRSLERLNR
GPGRVSVWGDRQQAQIPHPFRGGMGSQLCCGGCGHKSTVRYDKFDSITLPLPETAAPGLG
IGNLLSDFIQPETLDAVQCDACHETTAHTKTLTFSKLPACLCIHIARTTWHASGHVHKRL
DSVHFPETLSMAPYSFVQPGLNSNISTPWGSTTSLYSAGLMASGLDAVGGGAQAGPGAAD
APSGSMTFGSYTFGAMFPRNLYRLLAVIVHSGEANAGHFVTYRRGALRNSYKWYYTSDTI
VREVPIEEVLNSSAYMLFYDRGSSSKYP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgaaaaactgttgatggccgccggtgtgacggcggcagtcgtcgtcggtgcg
ttcgtcttctggggaccgtccggctcttccaagctgcggcagcggcggggccagatcgcc
gggctgcacaacttcggcaagacgtgctttctcaacacgctgctgcaggcgttggccgcc
tgcccgcagttcatcgcgtggctgcagctgcacaacaccaaggacaagaagagcctcgtc
tcgtcgctgcagaacgtgctggaggtggtaaacgggacgcatccgacgctgcggggcgac
ccgtacgcgccgggcgccgtcatccgcgcgctgcacgccctcggctgggtcatctcgccc
gaggagcacgacgcacacgagctgctgctggtgatgctcagctcgctcgaggaggaggtg
tcgaagccgcgcaagatcggctgcctgtccgatgcgctcgacgacgtggtcggcggtggt
ggtggtggcgggggtgacttgggcttccacgccataccggcccgcccgtccagcgcgatg
ctgtccgacttttgcaacgccgagtacgacgagtcgaccagcctgatgcggtacacccgg
tcggaggcgcacacgcccgattcgccccactcggtgtgcacggagaacgaggagcagtcg
caggaaagctcgctggtcgagttcggggcgtccccgtcgcacgcgatcagtgtcgcgttt
ggcggtcgccgctttggcagccggatgcagctgcagcagcagcagcaacagacgatggta
cggccgaccccgatgggtcgcgacgagcagacgagcgtgggcatgggggacgcgggcggt
aaccatttcgcgggcaagcggcactccgcctcgtaccggtcgctcgagcggctcaaccgg
ggcccgggccgcgtgtccgtgtggggcgaccggcagcaggcccagataccgcacccgttc
cggggcggcatgggcagccagctgtgctgtggcgggtgcggccacaagtccaccgtgcgg
tacgacaagttcgacagcatcacgctgccgctgccggagacggccgcgcccgggctcggc
atcggcaacctgctgtccgacttcatccagccggaaacgctcgacgcggtgcagtgcgac
gcgtgccacgagacgaccgcgcacacgaagacgctcacgttcagcaagctgcccgcctgc
ctgtgcattcacatcgcccgcaccacgtggcacgcgagcggccacgtgcacaagcggctg
gacagcgtgcactttcccgagacgctctcgatggcgccgtacagcttcgtgcagcccggg
ctgaacagcaacatcagcacgccctggggctcgaccacctcgctctactcggccggcctg
atggcgagcgggctggacgcggtcggcggcggggcccaggcgggaccgggagcggccgac
gcaccttccggctcgatgacgttcgggtcgtacacgttcggcgcgatgttcccgcgcaac
ctgtaccgcctgctggcggtcatcgtacattctggtgaggcaaacgccggtcacttcgtc
acgtatcggcgcggggcgctgcgcaactcctacaaatggtactacacgtcggacacgatc
gtgcgggaagttcctatcgaggaggtgctgaacagctcggcgtacatgctgttctacgat
cgcggctcgtcctccaaatacccgtaa

DBGET integrated database retrieval system