KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000300Help
Entry
AgaP_AGAP000300   CDS       T01036                                 

Definition
AGAP000300-PA
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aga00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aga00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
X
AA seq 2279 aa AA seqDB search
MGPKEMESERRDEPPPVEAAETVEYRPATASLVLEDGTIMHGHPFGAPLSVDGEVVFQTG
MVGYPESMTDPSYHGQVLVLTYPLIGNYGIPDADLDECGLMRHFESNNRIWTAGLVVGEI
CDEPSHWRSKLTLSEWMARHGVPGISGIDTRALTKKIRENGTILGKIVQSRVTSIAGFNF
SNQNLRNLVAEVSVAQPRTYNPTGSPRICAIDCGLKLNQVRCFVSRGARLDVVPWNARPD
PAEYDGLFLSNGPGDPETCREVVDNLRALLLPTDGPVKPIFGICLGHQILSTAAGCRTFK
MRYGNRGHNLPCMHLGTRRCYMTSQNHGFAVDSSEMPAGWEELFTNLNDGTNEGIVHRTR
PYFSVQFHPEHTAGPTDLEVLFDVFLEVVREYRGGVQASIDAAPTVRERLNDRLRFVPPV
PIELERPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEERIQTVLINPNIATVQTSKGL
ADKVYFLPITSHYVEQVIKAERPGGVLLTFGGQTALNCGVEMERAGLFARYGVRIMGTPI
RSIIETEDRKLFAERVGEIGEQVAPSAAVYSIQEALEAAERIGYPVMARAAFSLGGLGSG
FASSADELRALASQALAHSNQLIIDKSLKGWKEVEYEVVRDAYDNCITVCNMENVDPLGI
HTGESIVVAPSQTLSNREYNMLRSTAIRVIRHFGVVGECNIQYALNPESEEYYIIEVNAR
LSRSSALASKATGYPLAYVAAKLALAIPLPDIRNSVTGVTTACFEPSLDYCVVKMPRWDL
AKFARVSKNIGSSMKSVGEVMAIGRTFEEAFQKALRMVDSVSGFDPYLKPVNEQELEQPT
DKRMFVLAAALKAGYSVEQIYELTKIDRWFLRKMKGIIDFTIELEGLEHGCVPEAAMLRE
AKRLGFSDRMIAQCVKSTELAVRMQRKEHGVLPYVKQIDTVAGEWPASTNYLYLTYSATE
SDVEFPGQYTMVIGSGVYRIGSSVEFDWCAVGCLKELRRLNHKTIMVNYNPETVSTDYDM
CDRLYFEEISFEVVMDIYDAEQPTGIILMGGQLPNNIAMDLHRQQARILGTSPESVDSAE
NRFKFSRKLDRKGILQPRWKELTNLESAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQD
LKTYLKHASDVSKEHPVVISKFLIEAKEIDVDAVAADGVILCMAVSEHVENAGVHSGDAT
LVTPPQDLNRETLERIKEIARDIADLLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFV
SKTLDFDFVALATRVIVGHTDIEPVEVMHGRGLVGVKVPQFSFSRLAGADVMLGVEMAST
GEVACFGENRYEAYLKAMMSTGFQMPKKSILLSIGSYKHKMELLPSIRILEKMGYKLYAS
MGTGDFYTEHGVEVESVQWTFDSLAASEGDGGGNGGAGSELRHLAEYLANKQFDLVINPP
MSGGGARRVSCFMTHGYRTRRLAVDYSIPLVTDVKCAKLLVAAMQRIGGVPAMKTHIDCM
SSRLMVKLPGFIDVHVHLREPGAPHKETFATGTAAALAGGITMVLAMPNTQPAIVDRAAF
QQASELAQKGARCDYALYVGASSTNYGTVHELAAQAAGLKLYLNETFTTLRLNGLSVWQA
HLASWPKRAPLCVHAERETMAAVLLLASLTDRPIHVCHVARKEEILLIKAAKERGLKVTC
EVCPHHLFLSTADLDRIGAGRGEVRPVLCSPEDQQALWDNLDVVDVFATDHAPHAREEKE
SDNPPPGFPGLETILPLLLTAVTDGRLTMDELVSKFHHNPRRIFNLPEQPNTYVEIDLSE
EWIIPDRPQHSKAHWTPFSGRRVKGCVHRVVLRGETAYVDGLVLVGPGYGQNVREWHGGK
PPLLGAGSIERIDALNHSAGSGSGVGGLRPADLEPDLQTNEAFYQLLSPDGTNAHVKQLG
VHFAGEQSALRPVSPLPARVRCDSTGNQSVAGGSGRPLEPLGIHTAGLVRDRQLVGRHVL
TVDMFTKEHLNEIFHLAQTMKGRVAKERALDDLLRGKVMASIFYEASTRTSCSFAAAMQR
LGGRVVHVDETSSSAVKGETLEDSIQVMAGYADVVVLRHPLPGAVTRAAQHCRKPLINAG
DGVGEHPTQALLDIFTIREEIGTVNGLTITMAGDLKHGRTVHSLARLLTMYNVNVRYVCP
PGLEMPAHIREYVDRKGISQRQFDTLESAIADTDVLYMTRIQRERFESEQEYEKCCGQLI
LTPQIMTLAKRRMIVMHPLPRVFEISVEIDSDPRAAYFRQAEYGMYVRMALLAMVLGRI
NT seq 6844 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgaaagagatggagagcgagcggcgggacgagccgccaccggttgaggcggcc
gagacggtcgagtaccggccggcgacggcttcgctcgtgctcgaggatggcacgatcatg
cacgggcacccgttcggggcgccgctgtcggtcgacggcgaggtcgtgtttcagacgggc
atggtcggctacccggaatcgatgaccgatccgtcctaccacggccaggtgctggtgctg
acgtacccgctgatcggcaactacggcatcccggacgcggacctggacgagtgcgggctg
atgcgccacttcgagtcgaacaatcgcatctggacggcgggcctggtggtgggcgagatc
tgcgacgagccgtcgcactggcgcagcaagctgacgctgtcggagtggatggcccggcac
ggtgtgcccggcatcagcgggatcgatacgcgcgcgctcacgaagaagatacgcgaaaat
ggcacgattttgggtaagattgtgcagtcgcgcgtgacgtccattgccggcttcaacttt
agcaaccaaaacctgcgcaacctggtggcggaggtgtcggtggcgcagccgcgcacctac
aacccgaccgggtcgccgcgcatctgcgcgatcgactgcgggctgaagctgaaccaggtg
cgctgcttcgtgagccggggcgcccggctggacgtggtgccgtggaacgcacggcccgat
ccggccgagtacgacggcctgttcctgtcgaacggtccgggcgatccggagacgtgccgg
gaggtggtggacaatctgcgcgcgctgctgctgccgaccgacgggcccgtcaagcccatc
ttcggcatctgcctcgggcaccagatcctgtcgacggcggccggctgccgcacgttcaag
atgcggtacggcaaccggggccacaacctgccctgcatgcatctcggcacgcgccgctgc
tacatgacgtcgcagaaccacgggttcgcggtcgactcgagcgagatgccggcgggctgg
gaggagctgttcaccaacctgaacgacggcacgaacgagggcatcgtgcaccggacgcgc
ccgtactttagcgtccagtttcatccggagcatacggccggcccgaccgacctggaggtg
ctgttcgacgtgttcctggaggtggtgcgcgagtaccgcgggggcgtgcaggcctccatc
gatgccgccccgaccgtgcgggagcgcttgaacgaccggttgcgctttgtgccgcccgtc
ccgatcgagctggagcggccgaagaaggtgctgatcctcggctcgggcgggctttccatc
gggcaggcgggtgagttcgattactccggctcgcaggcgatcaaagcgctcaaggaggaa
cgcatccagacggtgctcatcaacccgaacatcgcgacggtgcagacgtccaaggggctg
gcggacaaggtgtacttcctgcccatcaccagccactacgtcgagcaggtgatcaaggcg
gagcggccgggcggcgtgctgctaacgttcggcggccagaccgccctcaactgcggcgtg
gagatggagcgggcggggctgttcgcgcggtacggcgtgcgcattatgggcacgccgata
cgctccatcatcgagacggaggatcggaagctgttcgccgagcgggtgggggaaatcggc
gaacaggtcgcaccgtccgcggccgtctactccatccaggaggcgctggaggcggcggag
cgcatcggctacccggtgatggcgcgggccgccttctcgctcggcgggctcgggtcgggc
tttgcgagcagcgcggacgagctgcgggcgctcgcgagccaggcgctggcccactcgaac
cagctcatcatcgacaagtcgctgaagggctggaaggaggtggagtacgaggtggtgcgg
gatgcgtacgacaactgcatcaccgtgtgcaacatggagaacgtggacccgctcggcatc
cacaccggggagagcatcgtggtcgcaccttcgcagacgctgtcgaaccgcgagtacaac
atgctgcgctcgaccgcgatccgcgtcatccggcactttggcgtggtgggcgagtgcaac
atccagtacgcgctgaacccggagtcggaggagtactacatcattgaggtgaatgcgcgc
ctgtcccgcagctcggcgctcgcgagcaaagcgaccgggtacccgctcgcgtacgtggcc
gcgaagctggcgctcgcgatcccgctgcccgacatacgtaactcggtgacgggcgtgacg
accgcctgcttcgagccgagcctcgactactgcgtggtgaagatgccgcgctgggatctg
gccaagtttgcgcgcgtcagcaagaacatcggcagctcgatgaagagcgtcggcgaggtg
atggcgatcgggcgcacgttcgaggaggcgttccagaaggcgctgcgcatggtggacagt
gtgagcgggttcgacccgtacctgaagccggtgaacgagcaggagctggagcagccgacc
gacaagcgcatgttcgtgctggcggccgcgctcaaggcgggctacagcgtggagcagatc
tacgagctgaccaagatcgaccggtggttcctgcgcaagatgaagggcatcattgacttt
acgatcgagctggaggggctggagcacgggtgcgtgccggaggcggcgatgctgcgcgag
gccaagcggctcggcttctccgaccgcatgattgcgcagtgcgtgaagagcaccgagctg
gcggtgcgcatgcagcgcaaggagcacggcgtgctgccgtacgtgaagcagatcgacacg
gtggcgggcgagtggccggcctcgaccaactacctctacctgacgtacagcgcgacggag
agcgatgtcgagtttccgggccagtacacgatggtgatcgggtcgggcgtgtaccgcatc
ggcagctcggtcgagtttgactggtgtgcggtcgggtgtctgaaggagctgcgccgcctc
aaccacaaaaccatcatggtgaactacaacccggaaacggtcagcacggactacgacatg
tgcgaccggctgtacttcgaggagatttcgttcgaggtcgtgatggacatttacgacgcg
gagcagccgacgggaatcatcctgttcgatggggggccagctgccgaacaacattgcgat
ggatctgcaccggcagcaggcccgcatactcggcacgtcgcccgagtcggtcgacagtgc
ggagaatcggttcaagttttcccgcaagctcgaccggaagggcatcctgcagccgcgctg
gaaggagctgaccaacctcgagtcggcgatcgagttctgcgaggaggtgggctacccgtg
cctggtgcggccgtcctatgtgctgtcgggggcggcgatgaacgtcgcctactcgaacca
ggacctcaagacgtacctgaagcacgcgtcggacgtgagcaaggagcatccggtggtgat
atccaagtttctgatcgaggcgaaggagatcgacgtggacgcggtggcggcggacggcgt
catcctctgcatggccgtgtccgagcacgtggagaacgcgggcgtgcattcgggcgacgc
gacgctggtgacgccgccgcaggacctcaaccgggagacgctggagcgcatcaaggagat
tgcgcgcgacattgccgacctgctggacgtgaccggcccgttcaacatgcagctgatcgc
gaagaacaacgagctgaaggtgatcgagtgcaacgtgcgcgtgtcgcgctcgttcccgtt
cgtgtccaagacgctcgactttgactttgtggcgctggcgacgcgcgtcatcgtcgggca
cacggacattgagccggtggaggtgatgcacgggcgggggctggtcggcgtcaaggtgcc
gcagtttagcttttcccggctggccggcgcggacgtgatgctcggggtggagatggcctc
gaccggggaggtggcgtgctttggcgagaaccggtacgaagcatacctgaaggcgatgat
gtcaaccggttttcagatgccgaaaaagtccattctcctcagcatcggtagctacaagca
taaaatggagctgctgccctcgatacgcatactggagaagatgggctacaagctgtacgc
gtcgatggggacgggcgacttttacaccgagcacggggttgaggtcgagagcgtacagtg
gacgttcgattcgctcgccgcgtcggaaggtgacggcggtggcaacgggggcgcgggcag
tgagctgcgccatctggcggaatatctcgccaacaagcagttcgatctggtgatcaaccc
gccgatgagtgggggcggcgcccggcgcgtctcctgcttcatgacgcacggctaccgcac
ccgccgcctggccgtcgactactcgatcccgctcgtgacggacgtgaagtgcgcgaagct
gctcgtcgccgccatgcagcgcatcgggggcgtgccggccatgaagacgcacatcgactg
catgtcctcgcggctgatggtgaagctgcccggcttcatcgacgtgcacgtgcatctgcg
cgagccaggcgccccgcacaaggaaacgttcgcgaccgggacggcggcggcgctggccgg
cggcatcacgatggtgctggccatgccgaacacgcagccggccatcgtcgaccgggccgc
gttccagcaggcgtccgagctggcccagaagggggcccggtgcgactacgccctgtacgt
cggcgcgtcctccaccaactacggcacggtgcacgagctggcggcgcaggccgccgggct
caagctctacctgaacgaaacgttcaccacgctgcggctgaacgggctgtccgtgtggca
ggcgcacctggccagctggccgaagcgggcgccgctgtgtgtgcacgcggagcgcgaaac
gatggcggccgtgctgctgctcgcctcgctgaccgatcggccgatccacgtgtgccacgt
ggcgcgcaaggaggagatactgctgatcaaggcggcgaaggagcgcggcctgaaggtgac
gtgcgaggtgtgcccgcaccatctcttcctgtccaccgccgatctcgaccggatcggggc
gggccgcggcgaggtgcggccggtgctgtgcagccccgaggaccagcaggcgctctggga
caatctggacgtggtggacgtgtttgcgacggaccacgcgccgcacgcgcgcgaagagaa
ggagtcggacaatccgccgcccggcttccccgggctggagacgatcctgcccctgctgct
gacggccgtcaccgacggccggctgacgatggacgagctggtgagcaagttccaccacaa
cccgcgccgcatcttcaacctgcccgagcagccgaacacgtacgtcgagatcgatctgag
cgaggagtggatcatcccggaccggccgcagcactccaaggcccactggacgccgttctc
gggccggcgggtgaagggctgcgtccatcgcgtggtgctgcgcggcgagacggcctacgt
cgacgggctggtgctggtcggcccgggctacgggcagaacgtgcgcgagtggcacggtgg
caagccgccgctgctcggcgccggctcgatcgagcgcatcgacgcgctgaaccactccgc
cgggtccgggtccggggtgggcgggctgcgcccggccgacctcgagccggacctgcagac
gaacgaagcgttctaccagctgctctcgcccgacggcaccaatgcgcacgtgaagcagct
cggcgtacactttgccggcgagcagtcggcgctgcggccggtctcgccgctgcccgcccg
ggtgcgctgcgactcgaccggcaaccagtcggtggccggcggctccggcaggccgctcga
gccgctcggcatccacaccgcgggcctggtgcgcgaccggcagctggtcggccggcacgt
gctcacggtcgacatgttcaccaaggagcacctgaacgagatcttccacctggcgcagac
gatgaagggccgggtggcgaaggagcgggcgctggacgatctgctgcgcggcaaggtgat
ggcgtccatcttttacgaggccagcacgcgcaccagctgcagctttgcggcggcgatgca
gcgcctcggcggccgcgtcgtccacgtggacgagacgtcctcgtccgcggtcaagggcga
aacgctcgaggacagcatccaggtgatggcggggtacgcggacgtcgttgtgctgcgcca
tccactgcccggtgcggtcacgcgcgctgcccagcactgccgcaagccgctgattaacgc
gggcgacggcgtcggcgagcatccgacccaggccctgctggacatcttcacgatacgcga
ggagatcggcacggtgaacgggctgacgatcacgatggcgggcgacctgaagcacggccg
gacggttcactcgctcgcccggctgctcacgatgtacaacgtcaacgtgcggtacgtctg
cccgcccgggctggagatgccggcccacatccgcgagtacgtcgaccggaagggcatctc
gcagcgccagttcgacacgctcgagtccgcgatcgccgacacggacgtgctgtacatgac
gcgcatccagcgcgagcggttcgagagcgagcaggagtacgagaagtgctgcggacagct
gatcctaacgccccagataatgacgctcgcgaagcggcgcatgatcgtgatgcacccgtt
gccgcgcgtcttcgagatcagcgtggagattgacagcgatccgcgggcggcctacttccg
ccaggccgagtatggaatgtatgtgcgcatggccctgctggcgatggtgctgggacgcat
ttga

DBGET integrated database retrieval system