KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000310Help
Entry
AgaP_AGAP000310   CDS       T01036                                 

Definition
AGAP000310-PA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 393 aa AA seqDB search
MPRKNKPPGIKLKLDGDLGAGGGGSTVPDSAEGATPRNLDKRGTLTVGERSFVVEADHLR
KLADLGRGAYGIVEKMLHQPSGTVMAVKRITVTSGMGAGGGPGGGVQSQEQKRLLMDLDV
SMRASDCRHTVQFYGALFREGDVWICMEVMDTSVDKFYPVVYKRPGRTIPEYILRQIALA
IVRALHYLHTELRVIHRDVKPSNVLMNRRGEVKMCDFGISGYLVDSVAKTIDAGCKPYMA
PERIDPGSGSRTAGYDIKSDVWSLGITMVEIATGRFPYATWRTPFEQLKQVVKDDPPRLP
KSAHPDADEFSPEFHAFIVSCLQKKYQLRANYEHLLATDFLGLYTADAERADNALMAQYV
CAILDERDGVVAPGAGPTDAAAGSGGGGEPAND
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggaaaaacaaaccgccgggcatcaagctgaagctggacggcgatcttggtgcg
ggcggcggcggcagcacggtgccggacagtgccgagggggcaacaccgcgcaacctggac
aagcgcggcacgctcacggtcggcgagcggtcgttcgtggtcgaggcggaccatctgcgc
aagctggcggatctgggccggggggcgtacggcatcgtggagaagatgctgcaccagccg
tccggcacggtgatggcggtcaagcgcatcacggtgacgagcgggatgggggcgggcggc
ggcccgggcggtggcgtccagtcgcaggagcagaagcgcctgctgatggacctggacgtg
tcgatgcgggcgagcgactgccgccacacggtccagttctacggggcgctgttccgcgag
ggcgacgtgtggatctgcatggaggtgatggacacgagcgtggacaagttctacccggtg
gtgtacaagcgccccgggcgcaccatcccggagtacatcctgcgccagatagcgctcgcg
atcgtgcgcgccctgcactacctgcacaccgagctgcgcgtcatccaccgggacgtgaag
ccgtcgaacgtgctgatgaaccggcggggcgaggtgaagatgtgcgacttcggtatctct
ggctatctggttgactcggtggcgaagacgatcgacgcgggctgcaaaccgtacatggcg
ccggagcggatcgatccgggctcgggcagccggaccgccggctacgacatcaagtcggac
gtctggtcgctcggcatcacgatggtggagatcgcgaccggccgcttcccgtacgcgacc
tggcggacgccgttcgagcagctcaagcaggtggtgaaggacgatccgccccggctgccc
aagtcggcccacccggacgcggacgagttcagcccggagtttcacgcgttcatcgtcagc
tgcctgcagaagaagtaccagctgcgggcgaactacgagcatctgctcgcgaccgacttc
ctcggcctgtacaccgccgacgccgagcgggcggacaacgcgctgatggcgcagtacgtg
tgcgcgatactggacgagcgggatggtgtggtggcgccgggcgccggccccaccgatgcc
gcagccggctccgggggtggcggtgagcccgcgaacgactga

DBGET integrated database retrieval system