KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000457Help
Entry
AgaP_AGAP000457   CDS       T01036                                 

Definition
AGAP000457-PA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AgaP_AGAP000457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 227 aa AA seqDB search
MAWRSKGSTQAELIRLMQEFNVIKTEAVAQTMIATDRKYYVPANVPQYQDEPQRIGHGAT
ISAPHMHAYALELLQSYLKPNSKVLDVGSGSGYLTACFARFIHRDPAATGYAVGIEHHPQ
LVTLGRQNIGQDDQSLIDTGKIVLIEGDGRRGCKDHAPYDCIHVGAAAPEIPQELVEQLK
PGGRMIIPVGPEGGNQRLVQIDKTSDGEIQNTKLMDVMYVPLTDLRK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgatcgaagggctcgacacaggcggaactgatccggctgatgcaggagttt
aacgtgatcaagacggaagcggtagcgcagacaatgatagcgaccgatcggaagtactac
gtgccggcgaacgtaccccagtaccaggacgaaccgcagcgaatcgggcacggtgccacc
atcagtgcgccccacatgcacgcgtacgcactggagctgctgcaatcgtacctgaagccg
aacagcaaggtgctggacgtcggttccggttcgggctacctgaccgcctgcttcgcccgc
ttcatacaccgggacccggcggcgaccgggtacgcggtcggcatcgagcaccatccgcag
ctggtgacgctcggccgccagaacatcggccaggacgaccaatcgctgatcgatacgggc
aaaattgttctcatcgagggtgacggacggcggggctgcaaggaccacgcaccgtacgat
tgcatacatgtcggggcggccgcgccggaaataccgcaagagctcgtcgagcagctgaag
cccggcggccgcatgatcataccggtcggcccggagggaggcaaccagcgcctggtgcag
atcgacaaaacgtccgacggcgagatccagaacacgaagctgatggacgtgatgtacgtg
ccgctcaccgatctgcgcaaatga

DBGET integrated database retrieval system