KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000500Help
Entry
AgaP_AGAP000500   CDS       T01036                                 

Definition
AGAP000500-PA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AgaP_AGAP000500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 587 aa AA seqDB search
MDAQTETEVPAGSVSDEPFLGPLDIVLLVSLLAGTAWYLLKGKKKESQASQFKSYSIQPT
TVNTMTMVENSFIKKLQSSGRRLVVFYGSQTGTAEEFAGRLAKEGIRYQMKGMVADPEEC
NMEELLMLKDIDKSLAVFCLATYGEGDPTDNCMEFYDWIQNNDLDMTGLNYAVFGLGNKT
YEHYNKVGIYVDKRLEELGANRLHKAGGRSCMHVEFDIEGSKMRYEAGDHLAMYPVNDRD
LVERLGRLCNAELDTVFSLINTDTDSSKKHPFPCPTTYRTALTHYLEITALPRTHILKEL
AEYCGEEKDKEFLRFISSTAPDGKAKYQEWVQDSCRNIVHVLEDIPSCHPPIDHVCELLP
RLQPRYYSISSSSKLHPTTVHVTAVLVKYETKTGRLNKGVATTFLAEKHPNDGEPAPRVP
IFIRKSQFRLPPKPETPVIMVGPGTGLAPFRGFIQERDHCKQEGKEIGQTTLYFGCRKRS
EDYIYEDELEDYSKRGIINLRVAFSRDQEKKVYVTHLLEQDSDLIWSVIGENKGHFYICG
DAKNMATDVRNILLKVIRSKGGLSETEAQQYIKKMEAQKRYSADVWS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccagacagaaacggaagtgcccgcgggaagcgtgagcgacgaaccgttcctc
ggcccgcttgacatcgtcctgctcgtcagtctgctggccggcactgcctggtatctgctc
aagggcaagaaaaaggaaagccaagctagtcagtttaaatcctactcgatccagccgacg
acggtgaacacgatgacgatggtggagaactcgttcatcaagaagctacagtcctcgggc
cgccggctcgtagtgttttacggttcccaaacaggcacggcagaggaatttgccggtcgc
ctggcgaaggaaggaatccgctaccaaatgaagggcatggtcgccgacccagaggagtgc
aatatggaagagctgctgatgctgaaggacatcgacaaatcgttggccgtgttttgctta
gcgacgtacggcgagggcgacccgacggacaactgcatggagttctacgactggattcaa
aacaacgatctagatatgaccggtttgaattacgcggtgtttggccttggcaacaaaacg
tacgagcactacaacaaggtcggcatctacgtggacaagcgtctcgaggagctcggtgcg
aacagactgcacaaggcgggcggccggtcctgcatgcacgtcgagttcgacatcgagggc
tcgaagatgcggtacgaggcgggcgaccatctcgcgatgtacccggtgaacgatcgcgat
ctggtcgagcggctcggccggctgtgcaatgccgagctcgatacggtcttctcgctcatc
aacaccgacacggacagcagcaagaagcatccgttcccgtgccccaccacctaccggacc
gcgctcacccactatctggagataacggcgctgccgcgcacccacatcctgaaggagctg
gccgagtactgcggcgaggagaaggacaaggagttcctgcgcttcatctcgtcgaccgcg
cccgacggcaaggcgaagtaccaggagtgggtgcaggacagctgccgcaacatcgtgcac
gtgctcgaggacatcccgtcctgccatccgccgatcgatcacgtgtgcgagctgctgccc
cggctgcagccccgctactactcgatctcctcctcgtccaagctgcacccgacgacggtg
cacgtgaccgcggtgctggtgaagtacgagacgaagacgggccggctgaacaagggcgtc
gcgacgaccttcctcgcggagaagcacccgaacgatggggagccggcaccgcgcgtacca
atcttcatccgcaagagccagttccggttgccgcccaagccggaaacgcccgtgatcatg
gtggggcccggcaccgggctggcaccgttccggggcttcatccaggagcgggaccactgc
aagcaggagggcaaggagattggccagacgacgctgtactttggctgccgcaagcgctcc
gaggactacatctacgaggatgaactggaagactactccaagcgcggcatcatcaacctt
cgcgttgcgttctcgcgcgaccaggagaagaaggtgtacgtgacgcacctgctcgagcag
gactcggacctcatatggagcgtgatcggcgagaacaagggacacttttacatctgcggt
gatgcgaaaaatatggccaccgatgtgcgaaacattctgctgaaggtcatccgctcgaag
ggtgggctcagcgaaaccgaggcccagcagtacatcaaaaagatggaagcccaaaaacga
tactcggcggacgtgtggagctaa

DBGET integrated database retrieval system