KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000532Help
Entry
AgaP_AGAP000532   CDS       T01036                                 

Definition
AGAP000532-PA
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AgaP_AGAP000532
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AgaP_AGAP000532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 1118 aa AA seqDB search
FLFALQNPNVVTRSSAKQSKVRTRAQQAATEAEQEERRVKLYGGYRSTGKGSIAEAKKQG
KLRMSATSQNGTGAGGDQRRSSDFTEVQLKDIFQNAQSGARTVRGPTGILYDERFALHRC
LWDTNYPECPERYLRVMERFTIGQLVDRCQFVAPRPATRAELLTKHTAEQIELLAQTHGS
QDEPELERLSSHYDAIFIHPTSYETSVLAVGSTIQLVESVWSGTVQNGMAILRPPGHHAM
TAEYNGYCFFNNVAIAAQHALDHLGTQKILIVDWDVHHGQGTQRMFYSDPRVLYFSIHRY
EHGTFWPNLRESDFDYVGTGKGEGYNFNVPLNKTGMTNGDYLAIWQQLLLPVATEFAPEL
IIVSAGYDSALGDEKGCMETPAFYSHLLSPLLLMAQGRVAVVLEGGYCLESLAEGCALTL
KTLLGDPAPRLAEALQPPSESMQASILNCIYSHRKYWKCLQLYELYDLEDYNNTNPQDNF
HKVIKCYVPPEPPAQPGRYETRNCYPVQSADERARIQDRLARLHLATDLSFPPDRVCYVY
DELMLEHRNSAEKWHPEQPERIAKIMQRLTGDYQLAQRMKRLPGRLATTEELCLVHGPEH
VRLIGEVCQSSTMKQTADQYNSIYFHPSTDASARMATGSVLTVVEDVLEGRTRSGVCVVR
PPGHHAEADTPHGFCIYNSIAVAARHAVKRYGLRRVLIVDWDVHHGNGTQHIFEQDPHVL
YVSVHRYDNGAFFPRSTDADYTVVGSGPGRGFNVNIPWNRKGMGDPEYVAAFHSVILPIA
YEYEPELVLVSAGFDAAIGDPLGGCRVTPEAYGHFTQWLSVLAGGRLVLCLEGGYNVNSI
SHAMAMCAKALLGDPLPMLLPVSGTARTPPATHASCCETLSNVLSVQRLYWRSLCFNKKL
PSSEPLLEETGSELIEALDNMTLSERGGTDQQQPQQTTSTPSSSSSATTAGSSGGEQAAG
SSKQPSQTLTEFLEANLEALQNEEMFAVIPRRDCPHLKLLRPETAPEAIDTRTPCSDCGA
EVENWICLLCFGVYCGRYVNEHMLRHGTGAADHPLALSFADLSVWCYGCDAYIDHPALHH
YKNLVHQDKFHEPLVWSYGSDLVLDVVPGSAGRKAGQD
NT seq 4909 nt NT seq  +upstreamnt  +downstreamnt
tttttgtttgcgttgcagaacccgaacgtggtgacgcgcagcagcgccaagcagtcgaag
gttcggacccgcgcccagcaggcagcaacggaggcggagcaggaggagcggcgggtgaag
ctgtacggtggctatcggtcgaccggcaagggcagcatagcggaggccaagaagcagggc
aagctgagaatgtccgccaccagtcagaacggcacgggggccggcggcgaccagcgccgc
agctccgactttaccgaggtgcagctgaaggacatcttccagaacgcgcagagcggggcg
cggacggtgcgcggccccaccggcatcctgtacgacgagcggttcgcgctgcaccgctgc
ctgtgggacaccaactatccggagtgcccggagcggtacctgcgcgtgatggagcgcttc
acgatcgggcagctggtcgaccggtgccagttcgtagcgccccggccggccacccgggcc
gagctgctgaccaagcacacggccgagcagatcgagctgctggcgcaaacgcacggctcg
caggacgagcccgagctggagcggctgagctcgcactacgacgccatcttcatccatccg
acgtcgtacgaaacgagcgtgctggcggtcggcagcacgatccagctggtcgagagcgtg
tggagcgggacggtgcagaacgggatggcgatacttcggccgcccggccaccacgcgatg
accgccgagtacaatgggtactgcttcttcaacaacgtggcgatcgcagcccagcacgcg
ctcgaccatctcggcacgcagaagatactgatcgtcgactgggacgtgcaccacgggcag
ggcacgcagcggatgttctactccgatccgagggtgctgtacttctccatccatcggtac
gagcacggcacgttctggccgaacctgcgcgagtccgactttgactacgtcggcaccggc
aagggcgaggggtacaacttcaacgtgccgctcaacaagacgggcatgaccaacggcgac
tacctcgcgatctggcagcagctgctactgccggtcgccacggagttcgctcccgagctg
attatcgtgtcggctggttatgattctgccctgggcgacgaaaagggctgtatggaaata
aacgcccgcgttctactcgcacctgctcagcccgctgctgctgatggcgcaggggcgcgt
cgccgtcgtcctggagggtggctactgtctcgagtcgcttgccgagggctgcgcgctcac
gctcaagacgctgctcggcgatccggccccacggctggcggaagcgctgcagcccccgtc
cgagagcatgcaggcgtccatcctgaactgcatctacagccaccggaagtactggaagtg
tttgcagctgtacgagctatacgacctggaggactacaacaacaccaacccgcaggacaa
cttccacaaggtgatcaaatgctacgtgccgccggaaccgccggcccagcccggccggta
cgagacgcgcaactgctacccggtgcagtcggcggacgagcgcgcccgcatccaggaccg
gctggcccggctgcacctcgccaccgatctgagcttcccgcccgaccgcgtctgctacgt
gtacgacgagctgatgctcgagcaccgcaacagtgcggaaaagtggcacccggagcagcc
ggagcgcatcgcgaagatcatgcagcggctgaccggggactaccagctggcgcagcgcat
gaagcggctgccgggccggctcgccaccaccgaggagctgtgtctggtgcacgggccgga
gcacgtgcgcctgatcggcgaggtgtgccagtcgagcacgatgaagcagacggccgacca
gtacaactcgatctacttccacccgagcacggacgcgagcgcccgcatggcgaccggctc
ggtgctgaccgtggtggaggacgtgctggagggccgcacccggtcgggcgtgtgcgtggt
gcgcccgcccggccaccacgcggaggcggacacgccgcacggcttctgcatctacaacag
catcgcggtggcggcccggcatgcggtcaagcggtacgggctgcggcgcgtcctgatcgt
cgactgggacgtgcaccacggcaacggcacgcagcacatcttcgagcaggacccgcacgt
gctgtacgtctcggtgcaccggtacgacaatggggcgttcttcccgcgcagcaccgacgc
ggactacaccgtcgtcggcagcgggccgggtcggggcttcaacgtgaacatcccctggaa
ccggaagggcatgggcgacccggagtacgtggccgcgttccactcggtcatactgccgat
cgcgtacgagtacgagccggagctggtgctggtgtcggccgggttcgatgcggcgatcgg
cgacccgctcggcgggtgccgcgtgacgcccgaagcgtacggccacttcacgcagtggct
gtcggtgctggcgggcggccggctcgtcctgtgcctcgagggcggctacaacgtcaactc
gatctcgcacgcgatggccatgtgcgcgaaggcgctgctgggcgatccgctgccgatgct
gctgccggttagcggcaccgcccgcacgcccccggcgacgcacgcgtcctgctgcgagac
gctctcgaacgtgctgtccgtgcagcggctctactggcggtcgctctgcttcaacaagaa
gctgccgagcagcgaaccgctgctggaggagaccggcagcgagctgatcgaggcgctcga
caatatgacgctgagcgagcggggcggcaccgaccagcagcagccgcagcaaaccacgtc
caccccgtcgtcgtcgtcgtccgctacgacggctggcagcagtgggggtgagcaggcggc
gggcagctccaaacaaccgtcccaaacgctgaccgaatttttggaggctaacttagaggc
actgcagaacgaggaaatgtttgccgtaataccgcgccgcgactgtccccatctgaagct
gctgcgaccggaaacggcccccgaggcaatcgacacgcgcacaccgtgcagtgactgtgg
tgcggaggtggaaaactggatctgtctgctctgcttcggcgtgtactgcggccggtacgt
gaacgagcacatgctgcggcacggtaccggggcggccgaccatccgctcgccctcagctt
cgccgacctgtccgtctggtgctacgggtgcgacgcgtacatcgaccatcccgccctgca
ccactacaagaacctggtgcaccaggacaagttccacgagccgctcgtctggtcgtacgg
cagcgacctcgtgctggacgtcgtgccgggcagcgccggccgcaaggcgggacaggactg
atactggccggacgtctcgaaggtgatctttcgagtgttggtgctgtttctgctgaaaaa
cattctcgtcggttacctgaagtaggcaaaaaaagcgggagagagagaacaaaaaaacaa
caaacaaacacgcctcccagagattgcgctagcccttgcttaaaaaaaaacaacttgcat
tacagcgttttccaggtgttctcatggttgtgggaactccttccttgattctttcttatt
ggaagtgaacttcatgtgttggaaattagactctattggcacgcttgctggacaggcttc
ctggatattcgtgttggatttgtccatcaagggtgctatagagtccaattcccattacat
taagttcatttcacgtaagaaggggtcaataactgtactggggaaaatggggatgtacca
cgggttgctgtacggcctgaacgctctccgccaaccggttccgttgtaacatatctttcc
gtaccaaaatgtgccggcagcggtaactatttatcatatataccatacgtaacgtcaaac
taacgcgcgtcgcgtcgtcctgctgtcgtccccactgtacacaatgttcgttctaatccg
ctgtatgcacaatttaacgattcctcttgaatgtgtgcgtgtgtgtgtgtgtgttttttt
ttgttctcaacgggagcataacgataccgataagagctacttacgataagtgttacagag
actatatagagcgtagagcgggataggatacagaagctgagggacaacgttaatgactct
tgtacaaatcaagcatgcaacagtgcgtgaatgttgaaagcaacgggtggcgaaagtaga
gtggaacagccactggccactgttcagatttgttttttttttgccggggtggggaaatgg
aaaagtttgttgaagaattgtgtaacttgtgtttaggatatactagctcaaaccaattat
actgcaactaaccaatttgtagagcgcgtagtagtagacaagcgagcaaaaagtaaaagt
aaaaggcatatgttaactagatattaactaagcaaattctattagcccgactaaaactgt
gcaacagcaggcgcacacacacacacgtgtggtaacaaaacaatactaaaacatttaacg
ctagcgctgttttgcacatgttaggacaggacatcctggttggccattccattttcatcg
tgtgtgtgtgtttgttagaaattttagaaaacctttttttctgtttgctgtagaccaaga
ttacgtattggcggttgcatttttaatcgttttttgctgttttttttaattcctttttgc
gaatgtacgaaaaagatgcggtcaggatggaagtgttagaatttgaagacgatagtgttt
ctgtgttttttttttcatattgaagattcattatatacaaaatcaacttgtttcaaatga
gaggagatagcgtgtgcgttagcaattgagagcaaagggagagcatgggagcgcgccggg
aaagtgttacaattatgtatgtttgttcaatagattattaacaaatagt

DBGET integrated database retrieval system