KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000847Help
Entry
AgaP_AGAP000847   CDS       T01036                                 

Definition
AGAP000847-PC
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AgaP_AGAP000847
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   AgaP_AGAP000847
Spliceosome [BR:aga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AgaP_AGAP000847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 1209 aa AA seqDB search
MSSSLSTMPFSRQYGSFRLSGNGTTGTCSSPASSGNHRVGHASRHSSGMETAGGQVPTAA
RLQIAPLGYRVGNLARNVSNNWLSNGSNGSSPTTTTTSFAAIRQQKISSSQEQHGPSGRP
GTTTTTVGGKQQPTDRCAVHRAAGALAAVPPAKKLPEQPIGDTPLLQSPRIIARSARIVE
PNAWNRRLTTSSFCTVAGTATSHHLHPHPHQQQQQLPNNRFLQTPLTCRKSPGSSGTSVE
SIVPKYSRPAGNSVSVVEPTTTSTTAAQKRTYNAHKPQLRVVSSRAHTNTTGRVGTVAKK
ATGPGCNAPIRTANVSPHDAEREVAKVLHQHNMRVIDLLNNNHLQSQRGGRVIKENNENH
QPAVSVNSGQNHQPGGKKGSAIPQRLPLADREQPTERNRRLLNVGGAGSGGSECFSSKFP
NGLPFEQEFYYRRTGQDTDTATLHEDKEEEEEGEEKEEEEEEEMTGHSHLIADAYQRIRK
AKKHALLPGRRQAGQIGGGVLLAGRRVAMTQQELPHRSRSVSSSEGALHEDDRCRSVSAI
EREHDDEDALYVDFTKVHDPQAMEQQQQRSKQHEEAGPQTSVVEYRNINHSSYYYKFESI
SSHARRNPAGQRKLGQRSRAGADAGSEHRPELRSRYQRSRLGLNRTGTGKPDVNGNGGRE
YYDDDVSDEPGENGLEEHEGDGEEEDEEEEGERSTVYVAVATWVPKCNRLPNESSEHGNG
NNNSICLTLATSSYGGEDIDQQQQQRPTKIGVAANHTAAATVAAAAVPPTSRKGVPIPAS
TRHGQLNPDAGRWERERNNDPELPTTSRTAVPLNPGRRVTRLQRRQVEQQEDQKQPFIRD
DADGHLIYQIGDILHNRYKILATLGEGTFGRVVKVKDLERNHVMALKIIKNVEKYRDAAE
LEIGALEKIMQLDPNLEHLCVKMLDWFDYHGHTCIAFEMLGLSVFDFLKDNNYEPYPIEH
VRHISYQLCYAVKFLHESRLTHTDLKPENILFVDSEYTTTTVPRKNREVRRVNCTDIRLI
DFGSATFDDEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYQGVTLFPTHDN
REHLAMMERILGTIPYRMARQTRSKYFRYGKLDWDEKSSTGRYVRDNCKPLHRCVITDKP
DHLQLFDLIRKMLEYEPSKRITLDKALRHPFFAKLPAHQRLHEKCNDSPVGAHSSTANAE
RERSHSLSR
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcagcctttccaccatgccgttctcgcggcagtacggctcgttccggctgtct
ggcaatggtaccaccggcacctgctcctcaccagcatcgagcgggaaccatcgggtcggg
cacgcttcgcgccattcctccggcatggaaacggccggcggacaggttcccaccgctgcc
cgcctgcagatagcgccgctcggctaccgcgtaggcaatctggcgcgcaacgtcagcaac
aactggctaagcaatggtagcaatggcagcagccctaccaccaccaccacctcgtttgcc
gccatccggcagcagaagatctcatcgagccaggagcagcacgggccgtcgggccgtccc
ggaacaacgacgacaacggttggcggcaagcagcagcccaccgaccgttgtgcagtgcat
cgtgctgcgggagcgttggcggcggtcccgccggccaagaagctgccggagcagccgatc
ggcgacacgccgttgctccagtcgccccgcatcattgcccgctcggccagaatcgtcgag
ccgaacgcgtggaaccggcggctcacgacgtccagcttttgcaccgtggccggaacggcc
actagccaccatctccatccccaccctcaccagcagcagcagcagctgccgaacaatcgg
tttctgcagactccactcacctgccgcaagtctcccggcagctccggcacgtccgttgaa
tcgatcgtgccgaagtactcgcggcccgcagggaacagtgtcagcgtggtcgagccaacc
accaccagcaccaccgccgcccagaagcgcacgtacaatgcgcacaagccgcagctgcgc
gtggtctcgagccgggctcacacaaacaccaccggtcgcgttggcacggtagcgaagaag
gcaaccgggccaggctgcaatgcaccgatcaggacagcaaacgtctcgccgcacgatgcc
gaacgggaggtggccaaggtgctgcaccagcacaatatgcgcgtgatcgatctgctcaac
aacaaccatctgcagagccagcggggcggacgggtgatcaaggaaaacaacgaaaaccac
cagccggcagtgtcggtcaacagtgggcagaatcaccagcccggcggcaagaagggttcg
gccataccgcaacggctaccgctagcggatcgggagcaaccgaccgagcgcaaccggcgg
ctgctgaacgttggtggcgccggcagcggtggaagtgaatgtttctccagcaagttcccg
aacgggttgccgttcgagcaagagttctactatcggcgcacgggacaggacacagacact
gccactctgcacgaagacaaggaggaggaggaagagggggaagagaaggaggaggaagaa
gaggaggagatgactggacacagccatctcatcgcagacgcataccagcgtatccggaag
gcaaagaagcacgcactactgccgggcaggcgtcaggcgggacagatcggcgggggcgtg
ctgctggcgggacggcgcgtcgccatgacgcagcaggaactgccgcatcgcagccggagc
gtgtcgtcttccgagggagccctgcacgaggacgaccggtgccgatcggtctcggccatc
gagcgggagcacgacgacgaggacgcactgtacgtcgactttaccaaggttcacgatccc
caggcaatggaacagcagcagcagcggtcgaagcagcacgaagaagccggtccgcaaacg
tccgtcgtcgagtatcggaacatcaatcacagcagctattactacaagttcgagagtatc
agctcccacgcccggaggaatccggccggtcagcggaagttgggtcagcgaagccgtgcc
ggagcggacgcgggcagcgaacatcggccggagctgcgcagccggtaccagcgatcccgg
ctcgggttgaaccgcaccggcacaggcaaaccggacgtgaatggtaatggcgggcgtgaa
tactacgacgacgacgtcagtgatgagccaggggagaacgggctggaggaacacgagggt
gatggagaggaggaggatgaggaggaagagggcgagaggtcgacggtgtatgtagccgtc
gcaacgtgggtgccgaagtgcaaccggttgccaaacgagagcagcgaacacggcaacggc
aacaacaactcgatctgtctcacgctcgcgaccagcagttacggcggcgaagacattgac
caacagcagcagcagcggcctacaaagattggagttgcagcgaaccacactgctgcagca
acagtagcagcagcagcagtaccaccaaccagtcgcaaaggtgtacccattccagcatcg
acgaggcacggccagctcaatccggacgctggccgatgggagcgtgagcgcaacaacgac
cccgagctgcccacaacgtcccgtaccgctgtgccgcttaatcctggccgacgcgtcaca
cgcctgcaaaggcgccaggtggaacagcaagaggaccagaaacaaccgttcatccgggac
gatgccgatggccatctgatctaccagatcggtgatatcctccataacagatataaaata
cttgccaccctcggcgagggtacgtttggacgcgtcgtcaaggtgaaggacttggagcgc
aaccacgtcatggcgctgaagatcatcaagaacgtggagaagtatcgtgacgcggccgag
ctggaaattggtgcgctggaaaagatcatgcagctcgatcccaacctggagcacttgtgc
gtgaaaatgctagactggttcgactaccacggccatacgtgtatcgctttcgagatgctt
gggctgagtgttttcgacttcctgaaagacaacaactacgagccatatccgatcgagcac
gtacggcacatctcctaccagctgtgctacgccgtcaagttcctgcacgagagccgcctc
acgcacacggacctgaagccggaaaacatactgttcgtcgactcggagtacaccaccacg
acggtcccacgcaagaaccgcgaggtgcgccgcgtcaactgtaccgatattcgactgatc
gattttggcagcgccacgtttgacgacgagcaccacagcaccatcgtctccacccggcac
tatcgcgcaccggaagtgatcctcgagctcggctggtcgcagccctgtgacgtttggtcg
atcggctgcatcatgttcgagctgtaccagggcgtaacgctcttcccaacgcacgacaat
cgcgaacatctggccatgatggaacggatcctgggcaccatcccttaccgcatggcaagg
caaacacggtccaagtacttccgctatggcaagctggactgggacgagaagtcttccacc
gggcggtacgtgcgggacaactgcaagccgctccatcgatgcgtcatcaccgacaagcca
gaccacctgcagctgttcgatctgattcgcaagatgctggaatacgaaccctccaagcgc
atcacactggacaaggctctgcggcatccgttcttcgcgaagcttcccgcacaccagcgc
ctgcacgagaaatgtaatgacagccccgtcggtgcccactcgtccaccgccaacgctgaa
cgcgagcgttcgcacagtctgtcgcgatga

DBGET integrated database retrieval system