KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000884Help
Entry
AgaP_AGAP000884   CDS       T01036                                 

Definition
AGAP000884-PA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:aga03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
X
AA seq 986 aa AA seqDB search
MVQQYVSATATVVNGTNAYELFCEQHHHKCNSAIATAAALQTAMKSLNSMVTHTMSNSLA
TLCNIGNSCYMNSVLYTLRFAPNFTHNLHHLVEFLELTLHKANAEKRCLPEHDEQGHGQD
EQSAINTKQKGSLLGAGSDGPDALGGHSWNGKELGLHEKHVNGYETHAAPYGRSSSASDG
SAMVSEICFSESEKCSAPANHARGCNAYGGASTPAYTGDSYNRSRKCEPSVSNGNGAKTN
RQLVCETLHELYHSLARNEAADTIEPFHAGGLLQAVQRVSSTFEGNQQQDAHEFLMCILD
SVRESCLKLNKTLIENPDFLKISSLPSLEKPAPAKGTFDSADSVTASTETKSSTQFIGRN
IFRRRKESLRNAKSFAAKESKANAAVELPLASSVKPMAPVSKCADAGAGKDKASLPHETT
TGGHGATAAEERLEERIRTLGLNFFCEDFEGVTVSRTRCLSCETVTEQKEIMIDIAIPIA
SSEISEALKNPQQFYQDACITQEYFRGDNKYRCEVCSGYTEACRTISFDILPRLLVLQLK
RFNGDMEKINSYIPTPFVLQCFCADCLGKSDSEKRHVYRLYSVITHVGARMSVGHYIAYT
SSLQIPLHYVNCVKDRQRRALLAASSLEAQAAGVPNGIKGVGISGKGHGGGVDKSASGQL
KKLFGSKKASSAGDISKKLKNNVINRFSPINGIENLQLNAHATTVCIEKAVRAGYSDNFY
SIQSMDGVSSARSAVDCSLGGGSNPCDGKTNHPLRSICDKASNLHDLHCQSVGCCAVLAK
NILADDIRHAGCAHAGSGTADEGGGLIGDGLRSSSGPGSAPHHLSPIVAGSMCEMNCAQS
RYKLDGANGESQSTIGNCHSSLLSSSSINNQGNSELSYGNFMDDTVARQQQQQQQQLTWY
MCDDDKVKIMTQLEFEEILSPNRRHVTTPYLLFYARYDIERKEHNQPKEQSASPTQQHQQ
QQYQHKMHKVITKHVPAATKSATISV
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcagtatgtatcggcaacagcaacagttgtgaatggaacaaacgcgtacgag
cttttctgcgaacagcatcatcacaagtgtaattccgccatcgccactgctgcggcactg
cagactgctatgaaaagcctcaacagtatggtcacccacaccatgagcaattcactggcc
acactatgcaacatcggcaactcgtgctacatgaactcggtgctgtacaccttgcgcttc
gcaccgaactttacgcataatttgcaccatctggtcgagtttctggagctgacgttgcat
aaagcgaacgcggagaaacggtgcctgcccgagcacgacgagcaggggcatgggcaggac
gagcagagcgcaatcaacaccaagcagaaaggctccctgctcggggcgggctcggatggg
ccggacgcgctcggtgggcacagctggaacggcaaggagctagggttgcacgaaaagcac
gtgaacgggtacgagacgcacgcagcaccgtacggccgatcgtcgagtgcgtccgatggt
tcggcgatggtcagcgaaatatgctttagcgagagcgagaagtgtagcgcacccgccaat
cacgcccgtggctgcaacgcgtacggtggtgcgtccacccccgcctacaccggtgatagc
tacaatcggtcccgcaagtgcgaaccgagcgttagcaatgggaacggtgccaagaccaac
cggcagctggtatgcgaaacgctgcacgagctgtaccacagccttgcgcggaacgaggcg
gccgacacgatagagcctttccacgccggcggactgctgcaggcggtgcagcgcgtgagc
agcacgttcgaagggaatcagcagcaggacgcgcacgaatttctcatgtgcatactggat
agcgtaagggaatcgtgtttaaagctgaacaaaactctcatcgaaaatccagatttcctc
aaaataagctcgcttccatccctagaaaagcctgcgcccgctaagggcacgttcgatagt
gctgactcggtgactgccagcaccgaaacgaagtctagcacacaattcatcgggcgcaac
atattccggcggcgtaaagaatcgctccgcaatgccaagtccttcgcggcgaaggagagc
aaagcgaatgccgcagtggagctgccgctggccagtagcgttaaaccgatggcgcccgtt
agcaaatgtgccgatgcaggggcgggcaaagacaaggccagcttaccgcacgaaacaacg
acgggtgggcacggtgcgaccgcggcggaggaacggctcgaagaacggattcgcacgttg
gggttaaacttcttttgcgaagatttcgaaggtgttaccgtgtccaggacgcggtgcctg
tcgtgcgaaacggtaaccgagcaaaaggaaatcatgatcgacattgctattccgatcgct
tccagcgagatcagcgaggcgctaaagaatcctcagcaattttatcaggacgcttgcata
acgcaggaatactttcgtggtgataacaagtaccggtgcgaagtgtgctcgggctacacc
gaggcttgccgtacgatatccttcgatatactgccccggctgctggtgctgcagctgaag
cggttcaatggcgatatggaaaaaattaacagctacatcccgacgccgttcgtgttgcag
tgcttctgcgccgactgtctgggcaagtcggacagcgagaagcgccacgtgtaccggctg
tacagcgtgataacgcacgtcggtgcgcgcatgtcggtcggacattacatcgcctacacc
agctcgctgcagatcccgctgcactacgtcaactgtgttaaggatcgccaacgaagggca
ctgctcgctgcctcttccctggaagcgcaggcggccggcgtgccgaacggcatcaaaggc
gtcggaatctcgggcaaggggcacggcggcggcgtcgacaagagtgcttccggtcaatta
aaaaagctgtttggcagcaaaaaagcctccagtgctggtgatattagcaaaaagctgaaa
aacaacgttattaatcggttctcccccatcaatgggatcgaaaacctgcagctgaacgcg
cacgccaccaccgtctgcatcgagaaggcggtgcgggccggctatagtgataacttttac
agcattcaaagcatggacggcgtcagctcggcgcgcagcgcggtcgattgttcgctgggc
ggcgggagcaatccgtgcgacggcaaaacgaatcatccgctgcgcagtatttgcgacaaa
gcgtcgaacctgcacgatctccattgccagagcgtcggttgctgtgccgtgctggcgaaa
aacatactcgccgatgacatccggcatgcgggatgcgctcacgccggaagcgggaccgcc
gatgagggcggcggcctgatcggggacggtttgcgcagcagcagtggcccgggcagcgcc
ccccatcacctatcgcctatcgtggcggggtcaatgtgcgaaatgaactgtgcacaaagt
cgctacaagctggatggtgcgaacggcgaaagccaatcaaccatcggcaactgtcactct
tcattgctgtccagctcgtcgattaacaatcaaggtaatagcgagctaagttatggcaat
ttcatggacgataccgttgcaaggcagcagcagcagcagcagcagcagctaacctggtac
atgtgcgacgatgacaaggtaaaaattatgacgcagctcgagttcgaggagatactgtca
ccgaaccggcgccatgtgaccacgccatacctgctgttttacgcgcgctacgacattgag
cgaaaggaacataatcaaccaaaagagcagtcggcatcgcccacgcagcagcatcagcaa
cagcagtatcaacacaaaatgcataaggtaataaccaagcatgtcccggcggcgaccaaa
tctgctaccatctccgtttaa

DBGET integrated database retrieval system