KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000960Help
Entry
AgaP_AGAP000960   CDS       T01036                                 

Definition
AGAP000960-PA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aga04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 421 aa AA seqDB search
MSAAQKQSHPVEMGPIEPHQRLQKLVADSQRVSIDPTMPINRYYRSGNQIVETADRSLRE
GNLEKAFTFYLRFVTIFVELILEHPGYRSVPPADKQLTKEKIKKIMPRAEEIRSKLLEKY
TTEYRLYLKQLQLQTEQEEREGEARKVAATAAAAAAAAAAAAAAAAAKSADQQPTTSYAP
SAPPSHVAVITDTDAKLIDQVLYPSDFLTDRSQATGLPSTGLLLAGEDGRRFDRALKPTA
PTGATAGVGFRSIVVPTDTMQKFLELAAANTAANLETCAILAGSLGQARFTITHVIFPKQ
SGTSDSCNTMNEEEIAVVQDRHNLITLGWIHTHPSQTAFLSSVDLHTHCSYQLMLEEAIA
IVCSPKYRETGFFNLTPHGMDSISQCRQTGFHPHPAGQPLFTEAQHIVLSDSVAARVIDL
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcccagaaacagtcgcacccggtcgagatgggaccgatcgagccgcaccag
cggctccagaagctcgtcgcggacagccagcgggtgtcgatcgatccgaccatgccgatc
aatcggtactaccgctccggcaaccagatcgtcgagacggcggaccgttcgctgcgcgag
ggtaacctggagaaagcgttcacattctatctgcggttcgtgacgatcttcgtcgagctg
atactggagcacccggggtacaggtcggtgccgccggcggacaagcagctgacgaaggag
aagattaagaaaatcatgccgcgggcggaagagatccggtcgaagctgctggagaagtac
accaccgagtatcggctgtacctgaagcagctccagctgcagaccgaacaggaggaaagg
gaaggcgaagcgcggaaggtagctgcgacggcggcagcggcagcagcagcagcagcggcg
gcagccgcagcggccgcagcgaaatcggcggaccagcagcccaccacgtcgtacgcgccg
agcgcccctccgagccacgtggccgtcatcaccgacacggacgcgaagctgatcgatcag
gtgctgtacccgagcgactttctgaccgaccgcagccaggcgaccggactgcccagcacc
gggctactgcttgccggcgaggacggccgccggttcgaccgggcgctgaaaccgaccgca
ccgaccggcgctacagcgggcgtcgggttccggtcgatcgtcgtgccgaccgacacgatg
caaaagtttctcgagctggccgccgccaacacggccgccaacctggaaacgtgcgcgata
ctggcgggcagtctggggcaggcccgcttcaccattacccatgtgatatttccaaagcag
agcggcacctcggacagctgcaacacgatgaacgaggaggagattgcggtcgtgcaggac
cggcacaatctcatcacgctcgggtggatacatacgcacccgtcgcagacggcatttcta
tcgtcggtcgacctgcacacccactgctcctaccagttgatgctggaggaagcgatcgcg
atcgtctgctcgccaaagtatcgagaaactggctttttcaatctcacaccgcacgggatg
gattcgatatcgcagtgccggcagacgggattccatccccatcccgccggtcagccactg
tttacggaagctcagcacatcgtactgagcgacagcgtggcggcccgagtgattgacttg
cgataa

DBGET integrated database retrieval system