KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001052Help
Entry
AgaP_AGAP001052   CDS       T01036                                 

Definition
AGAP001052-PB
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP001052
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP001052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
X
AA seq 339 aa AA seqDB search
MLRLCGIITGLCGLWNIGNTCFMNSMIQCLSHTRELTSFLRGQSSSERGTSKDHLILAEY
TKLIKNMWSGTQRSINPSDLKYAFSSKHRMYSGSAQQDAQEFLRFFLDSLHGALNAAIKR
DPLSEIDDNMNNKDKADMLWEWYSKAENSMIKDLFVGQLRSTLKCTFCNMESTMFDPFWD
LSLPLPSSSSRCKLENCLEMFIKEEIMDGIDQPTCSNCDTRRKCTKRLTIERFPRYLVIH
LKRFSEARWSKLTNIVEFPTKNRALNLQPYASEDISGPIYYSLYGISNHMGSTAGGHYVA
VCKHPQTQQWNEFNDNYVTEAFERNLVTSNAYVLFYERA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggttatgtggcataataacaggtttatgtggtctatggaatattggtaatact
tgcttcatgaactcaatgattcaatgcctcagtcacacccgagaacttacatcatttcta
cgaggtcaatcatcatctgaaagaggtactagtaaagatcatcttatattagcagaatac
acaaagcttatcaaaaatatgtggagtggaacacaacggagcattaatccatccgactta
aaatacgctttctctagcaaacaccgaatgtattcaggatcagcccaacaagatgcccaa
gagtttttaaggtttttcttagattctttacatggtgctttgaatgctgctatcaagcgg
gatcccttgtctgaaattgacgataacatgaacaacaaggataaagcagatatgctgtgg
gaatggtattctaaggcagaaaattcaatgataaaggatctgtttgtcgggcagttaaga
agtacgctcaagtgtacgttttgcaatatggaaagtactatgtttgatccattttgggat
ttaagtctacctctaccatcatcaagttcccgttgcaagctggaaaactgtctcgaaatg
tttatcaaggaggagattatggatggaatagatcaacctacgtgttcgaattgcgataca
cgtcgaaaatgcactaaaagattgacgatcgaacgttttccacggtatttagtaatacat
cttaaaagattttcggaagcacgttggagcaaattgaccaatattgttgagtttcctacc
aaaaatcgagctcttaatctgcaaccttatgcctcagaagacatttcgggaccaatatac
tattcactgtatggaatttcgaatcatatgggatctactgctggtgggcattacgtagct
gtttgcaaacacccacaaactcaacaatggaatgagttcaatgataactatgtcacagag
gcgttcgagcgtaatttagtcacctcaaatgcatatgttttattttacgaacgagcatag

DBGET integrated database retrieval system