KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001103Help
Entry
AgaP_AGAP001103   CDS       T01036                                 

Definition
(RefSeq) AGAP001103-PA
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04013  MAPK signaling pathway - fly
aga04068  FoxO signaling pathway
aga04140  Autophagy - animal
aga04150  mTOR signaling pathway
aga04320  Dorso-ventral axis formation
Module
aga_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP001103
   04068 FoxO signaling pathway
    AgaP_AGAP001103
   04150 mTOR signaling pathway
    AgaP_AGAP001103
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    AgaP_AGAP001103
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    AgaP_AGAP001103
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AgaP_AGAP001103
Protein kinases [BR:aga01001]
 Serine/threonine kinases: STE group
  STE7 family
   AgaP_AGAP001103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 1282062
NCBI-ProteinID: XP_322064
VectorBase: AGAP001103
UniProt: Q7PUQ2
Position
2R
AA seq 406 aa AA seqDB search
MSKMTKNKLNLTLPPGSVDVPAGQQTTPTPSFKTPSGTEYVIGKHNLLGKAKNSIDALTE
TLEELEMEESARKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHIPTQLIMA
RKLIHLEVKPAIKKQIIRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLIL
KRAGRIPEAILAKITSAVLKGLSYLRDKHAIMHRDVKPSNILVNSSGEIKICDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDAKTLDLIF
QERGEDCSPGQSIIEPKPMAIFELLDYIVNEPPPKLEHNSFTDRFKNFVDLCLKKNPEER
ADLKTLMNHEWIKNIETEDVDIAGWVCKTMDLAPSTPKRNASPFSN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatgacaaaaaacaaacttaatttgacgttgccacctggttccgtggatgtt
cctgctggacaacaaacaacgccaacaccctcctttaaaactccatcaggtaccgaatac
gtgattggaaaacacaatcttttgggaaaagctaagaacagcatcgatgcacttaccgaa
acattggaagaacttgaaatggaagaaagtgcacgtaaacgcattaaagtgtttctcagt
caaaaagaaaaaattggcgaactcagtgatgaggatttagagaaactaggcgagttgggt
tccggaaatgggggagttgtaatgaaggtacgtcacattcctacgcagctcataatggca
cgcaaattgatacacctagaagtaaaacctgcaatcaaaaagcagattatacgagaactt
aaggtattacacgagtgtaattttccgcacatagttggattctatggcgcattctacagt
gatggagagataagcatatgtatggaatacatggatggtggctcattagacctaatttta
aaacgagcaggaagaatcccggaagctattttggcaaaaataacatcggcagtactgaaa
ggactaagctatctgagagataagcatgccattatgcatagggatgttaaaccgagcaac
attcttgtaaatagcagtggagagataaagatttgtgatttcggcgtttccggtcagttg
attgattcaatggccaattcttttgtaggtactcgaagttatatgtcgcccgagcgctta
caaggaacgcattattctgttcaatctgacatatggtcactgggactctctttagttgaa
atggcgattggaatgtatccgattcctcctccagatgcaaaaacattagatttaatattt
caggagcgtggagaagactgctctcctggacaaagcataatagaacctaaaccaatggct
attttcgaactactggactacattgtaaacgaacctccgcctaagttagagcacaattct
tttaccgaccgttttaaaaattttgttgatctttgtctaaagaagaaccccgaggagcgt
gcagatttaaaaacactcatgaatcacgaatggattaaaaacattgaaacggaggacgtt
gatattgcaggatgggtgtgtaaaaccatggatcttgcaccatctacgcccaaaagaaac
gcgtcaccattttcaaattaa

DBGET integrated database retrieval system