KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001116Help
Entry
AgaP_AGAP001116   CDS       T01036                                 

Definition
AGAP001116-PA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AgaP_AGAP001116
   00330 Arginine and proline metabolism
    AgaP_AGAP001116
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    AgaP_AGAP001116
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AgaP_AGAP001116
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AgaP_AGAP001116
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     AgaP_AGAP001116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 350 aa AA seqDB search
MGNMKQIVVIGAGVSGLSVAVQLAEHYYNVANVTLISENVSPNTTGDGSAGLWGPYYCGN
TPDHKIVKWSSETHTFFHQLWKNGLGGKIGVCLQPCMRLTTDPNGYPEPAWKEIVFGCQK
IQEPELKRLSNEHGRSYTGGYHFATFTCEPSGLLPYLFNRFIAVGGKFVASKVRNFDEII
LNRPVDLIVNCSGLGSLELASDKAVLPIRGQVARVSAPWIYEVILDDSDDGNYIIPNCET
VILGGTHQMNDFNRNVKRDDSRFIFDGCERMLPSLRNASVTNEWVGLRPGRDSVRLEMEH
YRSDDQKGSVPIIHNYGHGGCGVTLCWGCAKEVVEISSTLGWSKSSTSKL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatatgaagcaaatcgtggtcattggtgctggtgtaagtgggcttagtgttgca
gtgcagttggctgaacattactataatgtggctaatgtgactttgatatccgaaaatgtt
agtcccaacacaacaggcgacgggtcggctggtttatggggtccttactattgcggaaat
actccggaccataaaatagtaaaatggtccagtgaaacgcacacgtttttccatcagctg
tggaagaatgggctcggcggaaagattggtgtctgcttacaaccgtgcatgaggcttacg
accgatcccaatggatatccggagccggcgtggaaggaaatagtgttcgggtgccaaaag
atccaggaaccggaattgaagcgactcagtaatgagcacggtcgatcgtacaccggtggt
tatcatttcgccacgttcacatgtgaaccatccggcctgttgccatacctgttcaatcgt
tttattgcggttggtggaaaattcgtggcgtccaaagttcgtaactttgatgaaatcatt
cttaaccggcccgtggatctgatagtcaactgtagtggccttggttcgcttgagttggcg
agcgataaggcagtgcttcccatccgaggtcaggtagctcgggttagtgctccatggatt
tatgaagtcattctggatgacagtgatgatggtaattacataattcccaattgcgagaca
gtgatattgggtggaacgcatcaaatgaacgacttcaaccgaaacgtcaaacgagacgac
agccgattcatattcgatggctgtgaacgaatgctgcccagtctgcgtaatgcaagtgtt
acaaatgaatgggtcggcctgcggcctggccgggacagcgtgcgcctggaaatggaacac
tatcgatcagatgatcaaaagggttccgttccgattattcataattacggacacggtgga
tgcggagtgacactctgttggggctgtgccaaagaagtcgttgagatcagcagtaccctt
ggctggagcaaatccagtacatctaaattgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system