KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001143Help
Entry
AgaP_AGAP001143   CDS       T01036                                 

Definition
AGAP001143-PA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AgaP_AGAP001143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 433 aa AA seqDB search
MATKKVSYFFNPDVGNFHYGPGHPMKPHRLSVIHHLVMNYGLHKKMQIYRPYKASAHDMC
RFHSDEYIEFLQRVTPQNIQGYTKCLSVFNVGDDCPVFDGLFEFCAMYTGASLEGAQKLN
HNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGDGVQE
AFYLTDRVMTVSFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYVQVFKPV
ISAVMEFYQPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKDLNVPTLVVGGGGYT
LRNVARCWTYETSLLIDETISNELPMNDYLEFFAPDFTLHPDIPSRQDNANSKQYLEAIT
RHVYDNLKMCQHAPSVQMFDIPEDALPEELKTVKTEEPNPDVRMTQDDEDRLVEPKNEFF
DGDNDNDKSENEP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaagaaagtgtcgtacttcttcaacccggacgtggggaactttcactacgga
cccggccacccgatgaaacctcatcgactttcggtcatccatcatttagtgatgaactac
ggtcttcacaaaaagatgcaaatttaccggccgtacaaagcgagtgcgcacgacatgtgc
cggtttcatagtgacgagtacattgagttcctgcagcgagtcacaccgcaaaacattcag
gggtacaccaagtgtctttccgtgttcaacgtcggcgacgattgtccagtgtttgatggg
ttgttcgagttctgcgccatgtacactggcgcttcgctggaaggtgcacagaagttgaac
cacaaccatagcgacatttgcatcaactggtctggcggtttgcaccacgccaagaagttt
gaggcgtctggattctgctatgtcaacgacatagtgataggcattctggagctcctgaag
taccatccgcgtgtcctctacattgacattgacgtgcatcatggcgatggggtacaggaa
gcgttctatctgaccgatcgcgtgatgacggtatcgttccataagtacggcaactacttc
ttccccgggacgggcgatatgtacgaaattggtgccgaatcggggcggtactattcggtg
aacgtgccgctaaaggaaggtatcgacgatcagagctacgtgcaggtgttcaaaccggtc
atttcagctgtgatggagttctaccagccgactgcgatcgtactgcagtgcggcgcagat
tcgctcgctggcgaccggctgggatgcttttcgctcagtacgaaagggcacggcgagtgc
gtcaagttcgttaaggacctgaacgtgccgacactggtggtcggaggcggtgggtacacg
ttgcgcaatgtggcacgctgctggacgtacgaaacttcgctgcttatcgacgaaaccatc
tcgaacgagctgccgatgaacgattaccttgagttttttgctcccgattttacgctccat
ccggacattcccagcagacaagataatgcgaacagcaaacagtacctggaagcgattacg
cgacacgtttacgacaacttgaagatgtgtcaacatgcacccagtgtacagatgttcgac
atacctgaggacgcacttccggaggagctgaaaacggtcaagacggaggaaccgaatccg
gatgtgcgtatgacgcaggacgatgaagatcgactggtggagccgaaaaatgagttcttc
gatggtgataacgacaacgacaagagtgaaaacgaaccgtag

DBGET integrated database retrieval system