KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001200Help
Entry
AgaP_AGAP001200   CDS       T01036                                 

Definition
AGAP001200-PB
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aga00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 1532 aa AA seqDB search
MADGVISIKLAIHDSNQGDGALYRLKKNSLVHVHPGASLLGRRVALYCNYPADDKEFCRK
TYRRLEWCSAAGSPLETSASGSEYTSIKDVDYYCNVHFTKSGAYHFYALYEECPEAGAQA
GLYVQIEPQLSVGSGEAATTLPLDAIRCQTVISKLLGPLDTWEAKLRVGKESGYNMVHFT
PVQELGGSRSAYSLRNQLRVNPDFQSKGGKEVSYDDLAVLMRKMREEWNVASICDIVLNH
TANESIWIREYPECSYNCFTCPHLRPAFLLDAMLARVGEDVKDGMLAHVGVPEVVETEDH
LQAIRWQIHSNYLPQVKLYELYQCDVDKYVSRFNDECSKRSPSRAQDIPEGDIKLRMDPE
HRRLGAEIDFERAMSIYNVFRQDCFDEDSRKRKCTEVFRARLQFLNEEVRREIQEHLDYA
IDNCLAGTRYERVQGDGPQVKGISVKYPLFMKYFTHYGTQGKSLKDIESMMYGGAGKLFM
AHNGWVMNGDPLKDFARAQPGTGNVYLRRELIAWGDSVKLRYGDKPEDSPYLWKHMQEYV
DTTARIFDGVRLDNCHSTPLHVAEYLLDSARKVNPELYVAAELFTNSDHTDNIFVNRLGI
TSLIREALSAWDSHEQGRLVYRYGGAPVGAFFPCPKRILAPGIAHALFMDLTHDNPSPVE
KRSIFDLIPSAGLVSMACCATGSNRGYDEFVPHHVHVVDEERQYQEWGKHVDKNTGLIAV
KEAFNVLHGGLASRGFDQLFVDQMHPDIVAVTRHSLSNHETVILVAHTAFSYPNPWAGPT
GVRPLEFEGEFKEIILEVQIYKKTGQTFDRPTDFAKNVDYINGVNEYVVDLKRNLKLEES
DIFAKEAVVKGNVTQLHFSNLKPGSVVAVRVALKENVRVHFDTLQSLVREFHQDRGSRYA
ELQHILSKLDLVDFNKLLYCCAEEERDNGGGPYNVEGYGDLVYCGLQGVMSILSDIGPNN
DLGHPLANNLRNGNWLIDYCSQRLMKYEKLVPMAKWLENNLKSLKEIPRYMIPSYFDVII
TNVHRLAMAAACNLMSDFVRHGSNFARRLALGSVQCVADCPSASLPKLSPNVSDPKPPSH
CATMAAGLPHFATGYMRCWGRDTFIAIRGLTLLTGRFDETRYMILGFGGCLRHGLIPNLL
DGGQNARFNCRDAVWWWLYTIKQYVEEAPNGKSILKDKVSRLYPTDDSEAKAPGECDQML
YEVIQEALTVHFQGLSYRERNAGTRIDAHMKEKGFNNRIGINPDTGFVFGGNNANCGTWM
DKMGSSDKAGNRGIPSTPRDGSAVELVGLQMASLRFMQAMAEQKVIPVSSVERTSYNGTK
TVWTYKEWANKIAANFEKEFYVDESCESNYANKRGIYKDTVGSEIAWTDYQLRCNFPIAL
LAAPELADPKHAWRALENAKKYLLGPLGMKTLDYEDWGYRGNYDNSIDSDDKTVAHGANY
HNGPEWVWPIGFYLRARLIFAKANGVLKETVAETWKILQTHLNELQRCHWRGLAELTNEN
GAYCKDSCRTQAWSMGCVLEVLYDLEKYEKEL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggggtcatttcaataaagctagccatacatgacagcaaccaaggggatgga
gctctctatcggctgaagaaaaactcgctggtgcatgtgcatccgggtgcatcgcttctg
ggacgccgggttgcgctttactgcaactacccagcggatgataaggagttttgccgaaag
acctacagacgactggaatggtgttcggcagcgggatcaccgttggaaacgagcgcgagc
ggatccgaatacacctccatcaaggacgtggattattattgcaatgtccactttaccaaa
tccggagcgtatcacttttatgccttgtacgaagagtgccccgaggcgggggcacaggct
ggcctgtacgtacaaattgagccgcagctgtcggttggatcgggagaggccgccacaacg
ctgcccctcgatgccatccgctgtcagacggtgatttcgaagctgctcggaccgttggac
acgtgggaagcaaagttgcgcgtgggcaaggagtcgggctacaacatggttcactttacg
cccgtgcaagagctgggcggatcgcgctccgcctactcgctgcgcaaccagctcagggtg
aatccggacttccagagcaagggcggcaaggaggtgagctatgacgatttggccgtttta
atgcgcaaaatgcgcgaagagtggaacgttgcatcgatctgtgacattgtgctgaaccac
acggccaacgagtcgatctggattcgggagtatccggagtgcagctacaattgcttcacc
tgtccgcatctgcggccggccttcctgctcgacgcaatgctggcccgtgtcggagaggac
gtgaaggacggcatgttggcgcacgttggcgtgccggaggtggtcgaaacggaggatcat
ctgcaggccatccgttggcagatccattcgaactacttgccgcaggtgaagctgtacgag
ctgtaccagtgcgatgtggacaagtacgtgtcgcggttcaatgacgagtgcagcaaacgc
agccccagccgtgcgcaggatattcccgagggcgatataaagctgcggatggacccggag
catcgccgactgggtgcagagatcgacttcgagcgtgcaatgagcatctacaacgtgttc
cggcaggactgtttcgatgaggacagtcgtaagcgcaagtgcactgaggttttccgcgct
cggttgcagtttctgaacgaagaggtgcgccgcgaaatacaggaacatctggactacgct
atcgacaactgtctggccggcacgcgctatgaacgtgtgcagggcgatgggccccaggtg
aagggcatatcggtgaagtacccgctgttcatgaagtactttacgcactacggaacgcag
ggcaaatcgctcaaggacatcgagagcatgatgtacggcggcgctgggaagctgttcatg
gcccacaacggatgggtgatgaatggggatccgctgaaggattttgcccgtgcgcaaccg
ggtacgggcaatgtgtacctgcgccgagagctgattgcctggggcgacagtgtgaagctg
cggtacggcgataagccggaggacagtccgtacctgtggaagcacatgcaggagtacgtc
gatacgacggcccgtatctttgacggcgtgcggctggacaactgccactcgacgccgctg
catgtcgccgagtacttgctcgattcggcgcgcaaagtcaacccggagctgtacgtagcc
gccgagctgttcaccaactccgaccacacggacaacatatttgtcaatcggctcggtatt
acgtcactgattcgagaggccctctcggcctgggactcgcacgagcaaggtcggctggtg
tatcgttacggcggggcaccggttggcgcattcttcccctgtccgaaacgtatcctggcg
ccgggcattgcgcacgccctgttcatggaccttacgcacgacaatccatcgccggtcgag
aaacggtcgatcttcgatctgatcccgtcggccggcctcgtgtcgatggcatgctgtgcg
acgggtagcaatcgtggctacgatgagttcgttccgcatcacgttcatgtggtggacgag
gagcgacagtatcaagaatggggcaagcatgtggacaagaacactggactgattgcggta
aaggaagcgtttaacgtactgcacggtggactagcgtcgcgtggcttcgaccaactgttt
gtcgaccagatgcacccggacattgtggccgtaacgcgtcactcgctttcgaatcacgag
acggtgatccttgtcgcgcacactgccttcagctatccgaacccgtgggccggtccgacc
ggcgtgcgtccgctcgagtttgagggcgagttcaaggagatcattctggaggtgcagatc
tacaagaaaacgggccaaacgttcgataggcccacggatttcgccaaaaatgtagactac
atcaatggcgtcaacgagtatgtggtggacttgaagcgcaatctgaagctggaagagtcg
gacattttcgccaaggaagcggtcgtgaaagggaacgttacgcagcttcacttctcgaat
ttgaagcccggctccgtggtggcggtgcgagtcgcgctgaaggagaatgtgcgggtacat
ttcgacacgctgcagtcgttggtgcgcgagttccaccaggataggggctcacggtacgcc
gagctgcagcacatcctgtccaagctggacttggtggactttaacaagctgctgtactgc
tgtgctgaagaggagcgtgataatggcggtggtccgtacaacgtcgaaggatacggcgat
ctggtgtactgtggcttgcagggtgttatgtcgattctgtccgatattggacctaacaac
gacctgggccatccgttggcaaacaatctacgcaacggaaattggttaatcgactactgc
tcccagcgtttgatgaagtacgaaaagctggtaccgatggccaagtggctggaaaacaat
ctaaaatcactgaaggaaattcctcgctacatgataccgtcctactttgacgttatcatc
acgaacgtgcaccgtttggcgatggcggccgcgtgcaacttgatgtcggactttgtgcgc
catggatccaactttgcgcgccggcttgcgctgggatcggtgcaatgtgtggctgactgt
ccatcggcaagcctgcccaagctaagcccgaacgtgagcgatccgaaaccaccgagccac
tgtgctacgatggctgccgggttgcctcacttcgcgacgggctatatgcgttgttggggc
cgggacactttcattgcaatccgtggcctgacgctgcttaccggacgcttcgatgagacg
cgctacatgatactcgggttcggtggatgcttgcggcatggattgatcccgaacctgctg
gacggaggtcagaacgcacggttcaactgtcgcgatgctgtctggtggtggctgtacacg
atcaagcagtacgtcgaggaggcgcccaatggcaagagcatcctgaaggacaaggtgtcc
cgtctctacccaacggatgactccgaagcgaaggcaccaggggaatgcgatcaaatgctg
tacgaagtgattcaggaagcgctaacagtccacttccaagggttgtcctatcgcgaacgc
aacgccggtactcgcatcgatgcccacatgaaggaaaagggcttcaacaaccgcattgga
atcaacccggacacgggcttcgtgttcggtggcaacaatgccaactgtggcacgtggatg
gacaagatgggctcctccgacaaggccggcaatcggggcattccgtcgaccccgcgtgac
ggttcggcggtcgagctggtcggactgcagatggccagcctgcggttcatgcaggcgatg
gccgagcagaaggtcatcccggtgtcgtcggtcgagcgcacctcgtacaacggcaccaag
acggtgtggacgtacaaggagtgggccaacaagattgcggccaacttcgagaaggagttc
tacgtggacgagtcctgcgaaagcaactacgccaacaagcgtggcatctacaaggatacg
gtcgggtcggagatcgcgtggaccgattaccagttgcgttgcaacttcccgatcgctctg
ctggcggcaccggagctggccgacccgaagcatgcctggcgtgcgctggagaacgccaag
aagtatctgctcggcccgctcggcatgaaaacgctcgactacgaggactggggctaccgt
ggcaactacgacaactcgatcgacagcgacgacaagacggtcgcgcacggtgcgaactat
cacaacgggccggagtgggtgtggccgatcgggttctacctgcgggcgcgtctaatcttc
gccaaggccaacggcgtactgaaggagacggttgccgaaacgtggaagattctgcaaacg
catctgaacgagctgcagcgctgccactggcgcgggctggccgagctgacgaacgagaac
ggtgcgtactgcaaggactcgtgtcggacgcaggcctggagcatgggttgcgtgctggaa
gtgctgtacgatttggaaaagtacgaaaaggagctttaa

DBGET integrated database retrieval system