KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001238Help
Entry
AgaP_AGAP001238   CDS       T01036                                 

Definition
AGAP001238-PB
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
aga  Anopheles gambiae (mosquito)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1618 aa AA seqDB search
MQRSVRVNENQLIMLSDRAQYDHSMHGYLHKRTSDNNKWQMRWFVLYQNLLFYYESEQSS
RPSGLIFLEGCYCERLVSAPSISGPPISTSTGQAPKIIKEEKLQHCFTICYRRENQRQYE
LRAATESECSAWIIAIREASFNKLLLQKEELEQKHVHLLQVVESEKTAKWQYTQQCEELA
SEIRKLRAEICVLRKETRSSYSATPVGRGSFSVPGDSQDDHGSLPGLCASVQDSIELRKI
KKVQSFFRGWLCRRRWKQIVEEYIRSPHAESMRKRNHLVFSMVEAEEEYLEQLEVLVACF
LRPFKMAASSKRPPCSHEDVNSIFLNSETVLFLHQIFLKGLTSRLESWPTLVLGDLFDML
LPMLSIYQEYVRNHHYSLQVLTECKSNTNFATVLKRLEAKPACQGRSLETFLTYPMHQIP
RYIITLHELLAHTPHDHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERMIVEG
CDILLDVNQVFVRQGSLVQVPPGRGRIRSRLASFKSERDAVRQCFLFSNHMIIATRTSGG
RLHLLPDVGKIPLADATLVEDPSEVQHDDEDASVCSASTRGSTLSVTESVNAGNRDFKIF
VESKSGARHGIHLVAPTIQDKEAWISDISQCLDNIHMHSLLSPGIGGSSGGKRAAMAVRV
SSLLAGHQALRADPRLFKDDVDIRFSRTLNSCKLPQVRYATPERLLQRLTDLRFLSIDFL
NTFLLTYRVFTDGETVLNALKSVFYDPPVEPSCDCEHQTDFLELPYQDGRASPRRTSGAS
SVSGYCSEGADRDRSMSGDSTGLRFRGSRRGYQNHQNSEQETLSWIPEQVGPVIIHSTHH
LNEKVVEEKPIEPTPTGGTVHLQSKSQHQLHQQPQDDSYLVIPKTMPGSSSSDTLTETAM
SGPSSPSNLSSVTLVGSTGSGGQDKSDDTPTEGTFKYGKAPTSPLPERVNPRAHKMATLA
TAAPPTPTICTTDTSQTEEEEPGQASRTPDKQQQPALDHQQHSPQHQQQQIKTPPTPPTV
TTTPCYSPANGQPPNGAPSPLHQPLQQQQSLPLKSEQATIVQGRLEIGGPKIVTQPYLTT
TTTTTVTITTTTTATSTKSISPPHLLPMDRRPSVGHNIAIPHAALCQHRHSLQLNGDGSL
FSKSEKTSSSPRLTTRKFSAPKTPERQRKSLFGTPQRDRDSSSTRRFSESDDDMATSIFT
TPRGSLGGVSLNTISSRASMQHDPVPHCSSKVGVVITSYRQSQRRSSTSTAAAAFAIATS
ASSNPRDEPPEVEARNRKESVVSSPATMRVLNVLRHWVSKHFQDFEQDAALRSQTIAFLD
DITCSPNLLPTEHRAASQLLRLLCRDDIDSGKLMLEILLTPPQTPSKESIETLSALEIAE
QMTYLDHQIFLAIRSEEFLGQAWMKSDKKSRAEHIILMTKRFNDGSRLVCSEIVSRSNMA
ARVAAIEKWTAVADICRCLHNFNGVLQICAAFTNAAVYRLKKTWDKVPRTIKSTITKLQA
VVCSDGRFRVMREALHRCDPPCIPYLGMYLTDLSFIEEGTPDFTPDGLLNFSKMRMIAHV
IREIRHFQQTPYKIDHIPKVTSYLLDTSLLLDDDELYHKSLQIEPRSSRLSAPNTANV
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttccgtgcgggtaaacgagaaccagctgattatgctgtccgatcgggcgcag
tatgatcattcgatgcacggctacctacacaagcgcacatccgataataacaaatggcag
atgcgatggtttgtgctctatcagaatttactcttctactacgaatccgagcaatcgtcg
cggccctccggactcatcttcctggagggctgctactgtgagcggcttgtttcagccccc
tcgatatcaggaccccccatatcaaccagtaccggtcaagctccgaaaattattaaggaa
gaaaaattacagcattgcttcactatttgctaccgacgagaaaaccagagacagtacgaa
ctgcgcgcagccactgagtcagagtgctcagcctggattattgcaataagagaggcaagc
ttcaacaaactgctactccagaaggaggaactcgagcagaagcatgtccatctgttgcaa
gtggtcgaaagcgagaaaacggccaaatggcagtacactcagcagtgcgaggagctggct
tcggaaatacggaagctacgtgccgagatttgtgtgctcaggaaggagacccgctcgagc
tactcggccacgccggtcgggcggggcagcttcagtgtgccgggcgactcgcaggacgac
cacggttcgctgccggggctgtgcgcctcggtgcaggattcgatcgagctgcgcaaaatc
aagaaggtgcagagcttcttccgcggctggctgtgccgccggcgctggaagcagatcgtg
gaggagtacatccggtcgccgcacgcggaaagcatgcgcaagcggaaccatctcgtgttc
agcatggtcgaggcggaggaggagtacctcgagcagctggaggtgctggtcgcgtgcttc
ctgcgcccgttcaagatggcggccagctcgaagcggccgccctgctcgcacgaggacgtc
aactcgatctttctcaactcggagacggttctgttcctgcaccagatattcctgaaggga
ttgacctcacggctggagtcgtggccgacgctagtgcttggcgatctgttcgacatgctg
ctgcccatgctgagcatctaccaggagtatgtgcgcaaccaccattacagtctacaggtg
ctgaccgagtgcaagagcaacaccaactttgccacggtgctgaagcggctggaggcgaaa
ccggcctgccaggggcgcagtctcgaaacgttcctcacctacccgatgcatcagatcccg
cggtacatcatcacgctgcacgaactgctcgcccacacgccccacgatcatgtcgagcgc
aagagtctgcaaaatgcgcgccagcagctcgaagatctgtcgcgtcaaatgcacgacgag
gtgtcggaaacggagaatctccgcaagaatctcgccgtcgagcgaatgattgtcgagggc
tgcgatattctgctcgacgtcaatcaggtgtttgtacggcaaggaagcttggtgcaagtg
ccgcccggtcgtgggcgaatacgcagccgcctggcctcctttaaaagcgagcgtgatgca
gtgcggcaatgtttcctcttctcgaaccacatgattatagcaacaagaacctcgggaggc
cgcctgcatcttctgccggacgttgggaaaattcccttagctgatgcaacgctggtcgag
gatccgagcgaggtgcagcacgacgatgaggatgcttcggtttgttccgcatctacccgg
ggcagtacgctgagcgtaacagagtcggtaaatgcgggcaaccgagattttaagatattt
gtcgagtcaaaatcgggcgcccgtcatggtattcatctggtagcgccgaccattcaggat
aaggaagcctggataagtgacatatcgcagtgtttggataatatccacatgcactcgtta
ctttcgccgggaattgggggatcttcgggaggtaagagagctgcaatggctgtgcgtgtg
tcatctcttcttgcaggccatcaagcattacgggccgatccgcggctcttcaaggatgac
gtagacatccgcttctcgcgtacgttgaactcgtgcaaactgccacaggtgcgctatgcc
acaccggagcgtttgctgcagcgtcttacagatctgcggttcctgtcgatagactttctg
aacacatttctgctcacgtatcgagtgtttacggacggtgaaacggtgctgaatgcgttg
aagagcgttttctacgatccgcccgtagagccatcgtgcgattgcgaacatcagaccgat
tttcttgagttaccgtaccaagatgggcgcgcttctcctcgccgcacgtccggagcgagc
tccgtttccggctactgttcggaaggcgctgaccgggatcgttcgatgagcggcgactca
acaggtctacgctttcggggatctcgccggggctatcaaaatcaccagaactcggagcag
gaaaccctctcctggataccggagcaggtgggccccgtaatcatccacagcacgcaccat
ctgaacgagaaggtggtggaggagaaaccgatcgaaccaactccaacgggaggcaccgta
catttgcaaagtaaatctcagcaccagcttcaccagcaaccgcaggacgactcgtacctg
gtaataccgaagacgatgcccggctcgagtagctccgatactttaacagaaacggccatg
agtggcccttcctccccgtccaatctgagcagcgtcacactggtaggatcaaccggttcc
ggcggacaggataaatcagacgacacgcccacggagggcacgttcaagtacgggaaagcg
cccaccagcccattgccggagcgtgttaatcctagggcacacaaaatggccaccctcgcc
accgcagcgcccccgacgcctaccatctgcacgacggacacaagccaaacggaggaagag
gaaccgggacaagcatcaagaacgcccgacaaacaacagcagccagcgctggatcaccag
caacattcgccgcaacatcagcagcaacaaattaaaacacctccaacgcccccgaccgta
acgaccactccctgctacagccccgcgaacgggcagcctcctaatggggcaccttccccg
ctgcaccagccgttacagcagcagcaatcacttccgctaaagtcggaacaagccaccatc
gtgcagggacggctcgagattggaggtccgaaaatcgtaactcaaccttatctgacgacc
acgactacaacgacggttacgataacgacgacgacaacggccacgtccaccaagagcatc
tcgccgccccatctgctgccgatggaccggcgcccgagcgttggccacaacattgccata
ccgcatgcagcgctgtgtcaacatcggcacagcctgcagctcaacggggatggcagtctt
ttcagcaagagtgaaaagacaagcagcagcccacgtttgacgaccaggaaattttccgcc
ccaaagacaccggaacgacagcgcaagagtctgttcggaacgcctcaacgagatcgcgat
tcttccagcacgcgccgattttccgaaagtgacgacgatatggccacgtccatcttcacc
acaccgcgtggatcgcttggcggtgtatcgctgaacaccatttcgtcccgagcttccatg
cagcacgatcctgttcctcactgctccagcaaagtaggcgtagtaatcacttcctaccgc
cagtcgcaacgcaggagtagcacatcgacggcagcggcggcattcgcgatcgctacctca
gcctccagcaatccccgggatgagccccccgaggtggaggctaggaaccgaaaggaatcc
gtcgtcagctcgccggccacgatgcgagtgctgaacgtgctgcgacactgggtgtcgaag
cacttccaggactttgagcaggatgcagctctgcgcagtcagacgatagccttcctggac
gacatcacctgcagtccgaacctattgcccactgagcatcgagctgcatcgcaactgctg
cgactactctgccgcgacgacatcgacagcgggaagctaatgctcgagatactgcttaca
ccaccgcagactccgagcaaagaaagcatcgagacactgtcggcgctggagattgcggaa
cagatgacgtatttggatcaccagatattcctggccatacgtagcgaagagtttctcggt
caggcctggatgaaatcggacaaaaagtcgcgtgcggaacatatcattcttatgacgaaa
cgtttcaacgatggctcacgattagtctgctcggaaatagtgtcaaggagcaacatggca
gcgcgggtagcggccatcgagaagtggacagccgtggcggacatttgccgctgcttgcac
aactttaacggggtgctgcagatctgtgccgccttcacgaatgcggccgtttatcgactg
aaaaagacctgggacaaagtacctagaacaatcaaatcgacaatcactaaactgcaggcc
gtggtgtgctcggatggaaggtttcgtgtgatgcgcgaggcactgcaccggtgcgatcca
ccctgcattccgtacctgggcatgtatctgaccgacctgtccttcatcgaggagggcacg
cccgactttacaccggatggactgctcaacttctccaaaatgcgtatgattgcccacgtt
atacgtgagatacgccacttccaacagacgccgtacaaaattgatcacataccgaaagtt
acatcctacctcctggatacatcgttgctgctggacgacgacgaattgtaccacaaatca
ttgcagatcgaaccgcgcagctcccgtctcagtgcaccgaacacggcgaacgtttaa

DBGET integrated database retrieval system