KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001257Help
Entry
AgaP_AGAP001257   CDS       T01036                                 

Definition
AGAP001257-PB
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aga00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aga00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aga00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aga00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 511 aa AA seqDB search
MLNIPNEKVRGHQRIPSDTKEFHEATKRDALMRLKKDLDHLLETVEESRKTGVQKEMCGF
EALYHRFLQEDGPSVEWDRIEKLPEEAVKDYSTLKLPQEAHIRDMLDKLVVVKLNGGLGT
SMGCHGPKSVIPVRNDLTFLDMTVQQIEFLNKKYNANVPLVLMNSFNTDVDTEKVIRKYK
GFQVQIYTFNQSCYPRISRDSLLPIAKDFDIENDIEAWYPPGHGDFYQSFQNSGLLRKFL
EEGREYCFLSNIDNLGATVDIKILNRLIGDDRQGDKPIEFVMEVTDKTRADVKGGTLIHY
ENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWARLESIERVLNAKTMNMEIIVNNKT
LDNGIRVIQLETAVGAAMKCFDGGIGINVPRSRFLPVKKTSDLLLVMSNLYSLKYGSLVM
SPQRMFPTTPLVKLGDNHFSKVKEFLSRFANIPDLIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatattcccaacgaaaaggtgcgcggacaccagcgcataccgtcggacacgaaa
gagttccacgaagcgacgaagcgcgatgccctgatgcgcctcaagaaggacctggaccat
ctgctggaaacggtcgaggagtcgcgcaaaaccggcgtgcagaaggagatgtgcggattc
gaggccctgtaccaccggttcctgcaagaggatggtccgtcggtcgagtgggatcgcatc
gagaagctgccggaggaggcggtaaaggactactccacgcttaaactgccccaggaggcg
cacattcgcgacatgctggacaagctggtcgtggtgaagctgaacggtggtctcggcacg
tcgatgggatgccacgggccgaagagtgtgattccggtgcgcaacgatctcacctttctc
gacatgaccgtgcagcagatcgagtttctgaacaaaaagtacaacgccaacgtgccgctg
gtgctgatgaactcgttcaacaccgacgtcgacacggagaaggtgatccgcaagtacaag
ggcttccaggtgcagatctacacatttaaccaaagctgctatccccgcatcagccgggac
tcgctgttgccgattgcgaaggattttgacatcgagaatgatattgaagcatggtaccca
cccggtcacggtgatttctaccagtcgttccagaactcgggactgctgcgaaagttcctc
gaggaggggcgcgagtactgcttcctgtccaacatcgacaatctgggcgcaacggtcgac
atcaagatactgaaccggctcattggcgacgaccggcagggcgataagccgatcgagttc
gtgatggaggtgacggacaagacgcgtgccgacgtgaagggcggtacgctgatccactac
gagaacaagctgcgcctgctggagattgcccaggtgccgaaggagcacgtggacgacttc
aagtcggtgaagacgttcaagttcttcaacaccaacaacatctgggcccggctggagtcg
atcgagcgggtactgaacgccaagacgatgaacatggagatcatcgtgaacaacaaaacg
ctcgacaatggcattcgcgtgatccagctcgagacggccgtcggtgcggcgatgaagtgt
ttcgacggtggtatcggcatcaatgtgccgcgatcgcgcttcttgccggtgaagaaaacg
tccgacctgctgctcgtcatgtccaacctgtacagcctgaagtacggctcgctggtgatg
tccccgcagcgcatgttccccaccaccccgctggtgaagctgggtgacaatcatttcagc
aaggtgaaggaattcctcagccgctttgccaatattcccgacctgatcgagctggaccat
ctgaccgtgtcgggcgacgtgacgttcgggcgaggggtctcgttgcgtggcacggtcatc
atcatcgctaaccatggcgaccgtatcgatattccggccggtgcaatcctcgagaacaag
atcgtgtccggcaacatgcgcattctggatcattaa

DBGET integrated database retrieval system