KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001356Help
Entry
AgaP_AGAP001356   CDS       T01036                                 

Gene name
ACES_ANOGA
Definition
AGAP001356-PA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AgaP_AGAP001356 (ACES_ANOGA)
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     AgaP_AGAP001356 (ACES_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 737 aa AA seqDB search
MEIRGLLMGRLRLGRRMVPLGLLGVTALLLILPPFALVQGRHHELNNGAAIGSHQLSAAA
GVGLASQSAQSGSLASGVMSSVPAAGASSSSSSSLLSSSAEDDVARITLSKDADAFFTPY
IGHGESVRIIDAELGTLEHVHSGATPRRRGLTRRESNSDANDNDPLVVNTDKGRIRGITV
DAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFP
GATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEE
NVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGES
AGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALRLAEAVGCPHEPSK
LSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILT
GSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTE
PDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMH
GDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGNPNPNTASSEFPEWPKHTAH
GRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSAFFYRPD
LIVLLVSLLTATVRFIQ
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgagggctgctgatgggtagactacggttaggacggcggatggttccgctg
ggtctgctcggcgtgaccgcgctgctactaatcctgccacccttcgcgctggtgcagggc
cggcaccacgagctcaacaatggtgccgccatcggatcgcatcagctgtcggctgccgcc
ggtgttggccttgcctcccagtccgcccagtccggatcgctcgcatccggtgtgatgtca
tccgttcctgctgccggagcgtcatcctcctcctcgtcgtcgctgctgtcatcgtcagcc
gaggacgacgtggcgcgcattactctcagcaaggacgcagacgcattttttacaccatat
ataggtcacggtgagtccgtacgaattatagatgccgagttgggcacgctcgagcatgtc
cacagtggagcaacgccgcggcgacgcggcctgacgaggcgcgagtcaaactcggacgcg
aacgacaacgatccgctggtggtcaacacggataaggggcgcatccgcggcattacggtc
gatgcgcccagcggcaagaaggtggacgtgtggctcggcattccctacgcccagccgccg
gtcgggccgctacggttccgtcatccgcggccggccgaaaagtggaccggcgtgctgaac
acgaccacaccgcccaacagctgcgtgcagatcgtggacaccgtgttcggcgacttcccg
ggcgcgaccatgtggaacccgaacacgcccctgtccgaggactgtctgtacattaacgtg
gtggcaccgcgaccccggcccaagaatgcggccgtcatgctgtggatcttcggcggcggc
ttctactccggcaccgccaccctggacgtgtacgaccaccgggcgcttgcgtcggaggag
aacgtgatcgtggtgtcgctgcagtaccgcgtggccagtctgggcttcctgtttctcggc
accccggaagcgccgggcaatgcgggactgttcgatcagaaccttgcgctacgctgggtg
cgggacaacattcaccggttcggtggcgatccgtcgcgtgtgacactgttcggcgagagt
gccggtgccgtctcggtgtcgctgcatctgctgtccgccctttcccgcgatctgttccag
cgggccatcctgcagagcggctcgccgacggcaccgtgggcattggtatcgcgcgaggaa
gccacactaagagcactgcggttggccgaggcggtcggctgcccgcacgaaccgagcaag
ctgagcgatgcggtcgagtgcctgcgcggcaaggacccgcacgtgctggtcaacaacgag
tggggcacgctcggcatttgcgagttcccgttcgtgccggtggtcgacggtgcgttcctg
gacgagacgccgcagcgttcgctcgccagcgggcgcttcaagaagacggagatcctcacc
ggcagcaacacggaggagggctactacttcatcatctactacctgaccgagctgctgcgc
aaggaggagggcgtgaccgtgacgcgcgaggagttcctgcaggcggtgcgcgagctcaac
ccgtacgtgaacggggcggcccggcaggcgatcgtgttcgagtacaccgactggaccgag
ccggacaacccgaacagcaaccgggacgcgctggacaagatggtgggcgactatcacttc
acctgcaacgtgaacgagttcgcgcagcggtacgccgaggagggcaacaacgtctacatg
tatctgtacacgcaccgcagcaaaggcaacccgtggccgcgctggacgggcgtgatgcac
ggcgacgagatcaactacgtgttcggcgaaccgctcaaccccaccctcggctacaccgag
gacgagaaagactttagccggaagatcatgcgatactggtccaactttgccaaaaccggc
aatccaaatcccaacacggccagcagcgaattccccgagtggcccaagcacaccgcccac
ggacggcactatctggagctgggcctcaacacgtccttcgtcggtcggggcccacggttg
aggcagtgtgccttctggaagaagtaccttccccagctagttgcagctacctcgaaccta
ccagggccagcaccgcctagtgaaccgtgcgaaagcagcgcatttttttaccgacctgat
ctgatcgtgctgctggtgtcgctgcttacggcgaccgtcagattcatacaataa

DBGET integrated database retrieval system