KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001396Help
Entry
AgaP_AGAP001396   CDS       T01036                                 

Definition
(RefSeq) AGAP001396-PA
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00562  Inositol phosphate metabolism
aga00920  Sulfur metabolism
aga01100  Metabolic pathways
aga04070  Phosphatidylinositol signaling system
Module
aga_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AgaP_AGAP001396
  Energy metabolism
   00920 Sulfur metabolism
    AgaP_AGAP001396
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AgaP_AGAP001396
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AgaP_AGAP001396
    3.1.3.25  inositol-phosphate phosphatase
     AgaP_AGAP001396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P PhaC_N
Motif
Other DBs
NCBI-GeneID: 1281781
NCBI-ProteinID: XP_321739
VectorBase: AGAP001396
UniProt: Q7PXG6
Position
2R
AA seq 346 aa AA seqDB search
MNLGRSIRINKCGVVILGLLFMCILYYLWSSNSANAASYAFSKNPNEINLRKLLIGSIQA
AQHGGFEVVAVSKSRDLHEQSKGKTKEGANNPVTDADYRSNCVMKNGLLRIFPKLKVISE
EDDRQEQCADVQLFDLDPTVLPESVTVPDERVSIDEVDVWIDPLDATQEYTERLHEYVTT
MVCVAVKGVPTIGIIHNPFSMKTTWAWRGKALSESLVNLKHDADVKHPTIIVSRSHAGAV
KEQSKQIFGENAQVITAGGAGFKVLQVIQNNATAYLHTTHIKKWDICAGDAILGAIGGRM
SDLHNENIAYHRDTPALNPNGLLAAALSSTHEAYIKRIVESKRFVR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgggcagatcgatacgcatcaataagtgtggcgtggtgatactgggcctgctg
tttatgtgcattctgtactatctctggagcagcaacagtgcgaatgcggccagctatgcg
ttcagcaagaatccgaacgagatcaacctgcgcaagctgctgatcggttcgatacaggct
gcccagcacggtggcttcgaggtggtggccgtgtccaagtcgcgcgatctgcacgagcaa
agcaagggcaagacgaaggagggcgccaacaacccggtgaccgatgcggactaccggtcc
aactgtgtgatgaagaatgggctgctgcgaattttccccaagctgaaggtgatctccgag
gaggacgaccggcaggagcagtgcgcggatgtgcagctgttcgatcttgaccccacggtg
ctgccggagagtgtgaccgtgccagacgaacgtgtctccattgacgaggtggatgtgtgg
atagacccgctggacgcgacccaggaatacaccgagcgactccacgaatacgtcaccacg
atggtgtgcgtggcggtgaagggcgttccaacgatcggcatcatacacaatcccttctcg
atgaagacgacctgggcgtggcgcggcaaggcactgtccgagtcgctcgtcaacctgaag
cacgatgcggacgtgaagcatccaaccatcatcgtgtcccggtcgcatgcgggcgctgtg
aaggaacagtcgaagcaaatattcggcgaaaacgcacaagtcataacggccggcggtgct
ggcttcaaagtgctgcaggtgatacagaacaacgcgacggcgtatctgcacacgacgcac
atcaagaagtgggacatttgtgccggcgacgcaatactcggcgcgatcggtggcagaatg
agcgatttgcacaatgaaaacatcgcgtaccatcgggatacgccggcgctcaacccgaac
gggctgctggcggcggccctttcctcgacgcacgaagcgtacattaagcggatagtggag
agcaagcgtttcgtgcggtaa

DBGET integrated database retrieval system