KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001420Help
Entry
AgaP_AGAP001420   CDS       T01036                                 

Definition
AGAP001420-PA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP001420
   01230 Biosynthesis of amino acids
    AgaP_AGAP001420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP001420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AgaP_AGAP001420
Enzymes [BR:aga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AgaP_AGAP001420
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP001420
  Exosomal proteins of melanoma cells
   AgaP_AGAP001420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 255 aa AA seqDB search
MAAKYRIVMVRHGESEWNQKNLFCGWFDANLSDKGKEEALAAGKAVKEAGLKFDIAHTSL
LTRAQVTLDSILKESGQTSIPIQKTWRLNERHYGGLTGLNKSETAAKYGEEQVLIWRRSF
DVPPPNMEPDHAYYDAIVKDERYKDDPKPNEFPMAESLKLTIARTLPYWNDVIIPQLKEG
KNIIIAAHGNSLRGIVKHLDQMTDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEET
VRKAIESVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaagtaccgcattgtgatggttcgccacggcgaatcggagtggaaccagaag
aatctgttctgcggctggttcgatgctaacctgagcgacaagggtaaggaggaagccctg
gccgccggaaaggccgtgaaggaggcgggcctgaagttcgacattgcccacacgtcgcta
ctcacccgtgcccaggtcacgctggactcgatcctgaaggagtcgggccaaacgagcatc
ccgatccagaagacctggcgcctgaacgagcgccactacggtggcctgaccgggctgaac
aagtccgaaacggcggccaagtacggcgaggagcaggtgctgatctggcgccgcagcttc
gatgtccccccgcccaacatggaaccggaccatgcctactacgatgcgatcgtcaaggac
gagcggtacaaggacgacccgaaaccgaacgagttcccgatggccgaatcgctgaagctg
acgatcgcccgcaccctgccgtactggaacgacgttatcattccgcagctgaaggagggc
aagaacattatcattgccgcgcacggcaacagcctgcgcggtatcgtgaagcatctggac
cagatgacggatgaggcgatcatgggcctgaacctacccaccggcatcccgttcgtgtac
gagctggacgagaacctgaagccggtcgtgtcgatgaagttcctcggcgatgaggagacg
gtccgcaaggcgatcgaatccgtcgctaaccagggcaaggccaagtaa

DBGET integrated database retrieval system