KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001420Help
Entry
AgaP_AGAP001420   CDS       T01036                                 

Definition
AGAP001420-PA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:aga01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aga01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aga00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aga00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 255 aa AA seqDB search
MAAKYRIVMVRHGESEWNQKNLFCGWFDANLSDKGKEEALAAGKAVKEAGLKFDIAHTSL
LTRAQVTLDSILKESGQTSIPIQKTWRLNERHYGGLTGLNKSETAAKYGEEQVLIWRRSF
DVPPPNMEPDHAYYDAIVKDERYKDDPKPNEFPMAESLKLTIARTLPYWNDVIIPQLKEG
KNIIIAAHGNSLRGIVKHLDQMTDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEET
VRKAIESVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaagtaccgcattgtgatggttcgccacggcgaatcggagtggaaccagaag
aatctgttctgcggctggttcgatgctaacctgagcgacaagggtaaggaggaagccctg
gccgccggaaaggccgtgaaggaggcgggcctgaagttcgacattgcccacacgtcgcta
ctcacccgtgcccaggtcacgctggactcgatcctgaaggagtcgggccaaacgagcatc
ccgatccagaagacctggcgcctgaacgagcgccactacggtggcctgaccgggctgaac
aagtccgaaacggcggccaagtacggcgaggagcaggtgctgatctggcgccgcagcttc
gatgtccccccgcccaacatggaaccggaccatgcctactacgatgcgatcgtcaaggac
gagcggtacaaggacgacccgaaaccgaacgagttcccgatggccgaatcgctgaagctg
acgatcgcccgcaccctgccgtactggaacgacgttatcattccgcagctgaaggagggc
aagaacattatcattgccgcgcacggcaacagcctgcgcggtatcgtgaagcatctggac
cagatgacggatgaggcgatcatgggcctgaacctacccaccggcatcccgttcgtgtac
gagctggacgagaacctgaagccggtcgtgtcgatgaagttcctcggcgatgaggagacg
gtccgcaaggcgatcgaatccgtcgctaaccagggcaaggccaagtaa

DBGET integrated database retrieval system