KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001458Help
Entry
AgaP_AGAP001458   CDS       T01036                                 

Definition
AGAP001458-PA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     AgaP_AGAP001458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 354 aa AA seqDB search
MSCNYAEGLSKYENKGVLGVAEIFDTPELVEEKCEQLVKMMLASSHTVVHTGAGISTSAG
IPDFRGPNGVWTLEEKGEKPAVNISFDDAVPTRTHMALKSLVASGHVQYIVSQNIDGLHL
RSGLAREHLSELHGNMFLEVCTKCRRQYVRSSPAPTVGKKETGNICPGTSAERACRRGKL
IDNILDWEHDLPENDLQLAFMHSAMADLNICLGTTLQIVPSGDLPLKNLKHGGRLVICNL
QPTKHDKKADLKISTYVDAVLERVAKRLGVEIPEYRREEDPTKRDTYSVQWNIDGKMVKS
LEKRYDSTIKEKNQLKKRCSTSSIDQDREDLKRNNKKLKQEQPSNATNEGDLNS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcaattacgctgaagggctgtcaaaatatgaaaacaagggtgtgcttggtgtg
gcagagatctttgatactcccgaactggtggaggaaaaatgcgagcagctggtgaaaatg
atgcttgcctcgagccataccgtcgtgcacacgggtgctgggattagcacgagcgcgggc
ataccggatttccgcggccccaacggtgtctggacgctggaggagaaaggggaaaaaccc
gctgttaatatttcgttcgatgatgccgtgcctacccgcacgcacatggctctgaagtcg
ctcgtagccagtggtcacgtgcagtacatcgtcagccagaatatcgacggtttgcatctg
cggtcagggcttgcgagggaacacctgtccgaactgcacggcaatatgtttttggaggtg
tgcaccaaatgtcgtcgtcagtacgtacgaagcagtccagcgccaacagtgggcaaaaag
gagactggaaacatttgtcccggcacgagtgcggagcgcgcctgtcgtcgaggcaagctg
atcgacaacatcctagactgggagcatgatctacctgaaaatgatctccaactggcattt
atgcattccgcgatggcagatcttaacatctgccttgggacgacattgcaaatcgtgccg
agcggtgatctaccgctaaaaaatctcaaacacggaggacgactcgtcatctgcaatctg
cagccgaccaagcatgacaaaaaggcagatttgaaaatttcaacctacgttgatgcggtg
cttgaacgagtggccaaacgattaggtgtagaaatacctgagtatcggagggaagaagat
ccaaccaaacgcgatacgtacagtgtgcagtggaacatcgatggaaaaatggtgaaatca
ttagaaaaacggtacgatagtacgataaaagagaaaaaccagctaaagaagcgatgttcc
acatccagcatcgatcaggaccgcgaggatttgaaaagaaacaacaagaaactaaaacaa
gaacaacctagcaatgcaacaaatgaaggagatctaaatagttga

DBGET integrated database retrieval system