KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001535Help
Entry
AgaP_AGAP001535   CDS       T01036                                 

Definition
AGAP001535-PA
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AgaP_AGAP001535
Enzymes [BR:aga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AgaP_AGAP001535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 3613 aa AA seqDB search
MTIVKSNTADAAGTNPADNAKSPLSSSSSSSSSSDSDDGSDSSSDSDSSSASTSKTSSKQ
SSGGGGGGVPPEKPQQFSVMSSDSAGLRMKIAIPRSQSNATPTPSPTASLGSNHQHQQLM
QQDSLPAGGGAAAVAADRRQKNAENVLGGERASPAGSSTKVDSFKDGATKKGSNTAKSAM
VAAVEASSTRARAPPTAQQRVSSEGGGSKALTATAASRKQGSRMLPDDKREERGRTMHTK
ARKRRSSSGNDGSSAGRTKKSVSESDSSSASSSFSSCTSNSDSDTSSTAGDNSNHHQQQQ
DDKAKQTVGGGRHARTASSAAVASGSAIAAGKKQKILKRKKASRTATSSSSDEEDEEDLP
SGRSGSKSGTANRTNEFTSSDSSSSDEDGKAFAAMRTKAKSLQSTKGSGKDGNGLLTLTD
GSAGGLLLNRPPLSTSTPAKQHGAFPPTLGGGMSSAGDGGLTAEGGSCSSDNELPALVSA
AIRRVESGSDAESIRGLSAPTQQYTSSLLRDFVVKTQMLGTVGGGGAGAMPAGVSGSAAN
SAGGGGGGGGSPSSSSSSSSSSGSSSSSSSSSMEEGADPAIGSAGPGPGGGGGGGVAAFE
LDVRKIKTESPVPSTLPPASVGRNTPLVNGLTTGGMKTTDLPVPAPAPKRRGRPPKSSLQ
AAPAPPPAARPTGSSRSVTIPTVSESPDSGILSTHSSTGSPKTDKTRSASHLRSTVGATG
SSTSSRRSKSEARGSASSASSAILSAGGAAYAANSVLPAPPGAAGSGSRTSGAAASSYAL
TSCLDRNTYATERVLYPPRGPKKRGVGRPPKKDTTAHQQPAGAGRGGSANDPAARSQQQA
EDRLDPHWQKIDISKKFHEPRLSGYKSDGGHSTICCSKRLASQSGYISDYGGVGASSGRS
RLSGYKSDFSSRSRRSCSRAGGYRSDYGRAKSCGYRSDCSTRHRKQVRRKRRKKIGSHQQ
SQQQHHNQHDQQHHNNNLSDRKNYNASSDGGGGGGSTKSASVGELEIMFMAGLTLGSTSD
EDSSSTSSSTSSSSAESRESLFTDHSGVDRGANSSSGADKVKRATSGRGRKANVATTKPN
AKLPRTPRKPTPPKTVAKGRGAAKAPRGRPPSSTTIDRRRKANHAKHGSNKLDSDDEDED
EEEEAELVVKRRFGDRVRTKPLQPAPKDPPTKPSVAATASVALKQKSSALVKKPGQRGRP
PGVKKQPGGTGSTATAAALPAGKTLGSLDVLLAPKNSTAPVLPVNNFDRVVASMSGSSSG
KQQPGSSEAKKSSIYTFSSTTVAPKNAFAAFLLRGAAADDASKDDAEEGGRLLGVKKLPL
SKANVIKNSEECSRRFQKSTSSFALGGIAGSVDLLARIADGTIPKASPTKSVCSKRSRRK
SCASDRLEVMSVKSYGVIGSCGKIRQRRLSTMSRCSSRSAGSRHAAARMRRRKKRLRSMS
VAPGTTAEMVSGGGGGSGHAAGGAPSSSGLDLKLNVEIDRLSESFSGMCRIVGGTVNNEA
GQASSGAGRSVSPPEETTATNAPAAATPTSGKGHQTKRSVKKRKASEHVTDSPSTAGGAN
APGGGGGGAAALGNGGGAGGGGGTGKRRNKKTVPTQSPDDHKLPLKKRHYLLTPGEKGNN
SDNNSGVDEVKTGSSGGNGGGVGGSSATAAGSNVDSGNSSTSGATGSGSGSANSSFTGSH
TVLNPCAFASGARSSANSAAAGSSISGAATKAVTPKKRHLLKSPEPGPVPTDTELQLQIK
SSDSPLTIVNGGGASGTVGDAGSSPSDGHTVGRKAAVDGAVGGSPSNAAGQANPPVAGSK
KKTNRQQEGSSISSSTVSRERQATGASGQPGTTSDNSAGPQHRSTPPARPSVIQSSGSVH
PAASSGAYSASSAGPPPGVFEPTVDLELVIPPPSSIPSLIAKVEMLDSPRLGGKDVAAAA
GAIGSSSSGSSGNVATKLESEELQVLTAAQRKAAGLGAGSALLATISTASASSEKVLEKL
LTKTGAHHLLMKKKRKKPNRTGFPTVKKKKKKLPENDPLDDGLSVLDLKPEVGPDLFDSS
NLTRHVPSEAEKTRMKERQQQHHPTTGKHAACDRVPKEGEPTDCFIERHTGVGRPRLSVV
SLEKLQGKLPLPGGGSRDVATTPPATGGRGRKSVINPLAAEHQLAAHRSRGLRDEPPAAA
AGTVGRKGKKRQEAPKPLPETAVGKRQKASMDTEIRSAKERNRSKSVSVASEQLPNIVRL
SETLSKGAAAKENKENSRLPPGRPPSAAKRAGKEPATSAETSPQDDAAGVIRRTRSSSVA
LDPSEVKKLHHHHHQQHDAEHESAGKGASQSSTPVRPHSGGIAALHNEDSTSLDSMPLLK
RLHSRSISRMQSVITPTVVIEPIATSPKTPGRPRGRPRTTSPITATETPNSPTATTGPGR
GRPRTALALTGNPSAASMQRTPASPLSSPSPTVAAAERTAGRKKQRLDGRKSVPPGLAEP
IESARLATRVTASKSVTPTPPVGTVIPTRLKRGKSDETLRAQQLEKPTKKPRKELPGSAE
PSPETAAHLSKRSAIVSPIVEPVDPEETAHVLQPASSTEELEHDPLPPDEGPSDFLRLTD
TPSPTSSGEARELAMGGAAAAGGRGAGTSKKLPRKKYITAGLFSDCYKDDGTTGGEGRSG
PKTPPETLLPPPAYCERFLRRTVRDFQLPYDLWWLQENGKLPGRNSVPSWNYRKIRTNVY
YDVKANPSTDNNTQCNCKPDSGCQDDCLNRMVYTECVPEQCPCGDRCRNTCIQRHEYAPG
LERFMTEEKGWGIRSRERISKGTFIMEYLGEVVTEREFKERMRTMYLNDTHHYCLNLDGG
LVIDGHRMGSDCRFVNHSCAPNCEMQKWSVNGLFRMALFAMRDIPPNEELCYDYNFSLFN
PSEGQPCRCGSEQCRGVIGGKSQRIKPIPLGSSGGGASGPGGTGGQRNASEAGADTDASK
AAGADGTAGGNGASGALVVELSPRSAARSRKRQAKKNQPIVHLNGTPLPTFHPPSVKERA
LIAEHHCFLLRNLNKIRRQKERAATLASAGGGGNGGAGAAATESGGQGAAAGSDQTAGGS
GKPSLASQISALRCPRNIRTRGLAFVEDDPELEKTARIAVALKDICTEIATLKDDKGVPF
ISKLQLPSKKKTPLYYERIPKPIDLAQIETNIEQGVYRMPKVFEEDLLIMLSNAIKYYGI
NSPEGIASEALKSHYYTCKQQQVPKLQAYIGEENELLRGFVPKKEPAEDAVPPKPKRGRR
QEQPEDIIRCICGLFKDEGLMIQCSKCLVWQHIECTKADPAVENYLCEKCDPREVNYEIP
LNEFTEEGYQYYVSLMRGKLQIRQTDTVYVLRDIPMSPDPKNPNAPVRKHTYETIGKIEY
SECDIFRVESLWKDKEGRRFVYGHHYLRPHETYHEPTRRFYPNEVMRVPLYEVIPIELVV
DRCWVLDPITFCKGRPVDSSEPHVYICELRVDKSARLFSKISRHSHPVCMKSYAFHKFEQ
KLKIAKTFAPHDLGSLAHLLSIRDKQKKGSKKDDGSGGQTSAGSAAGGSSGFGGAGGSHS
GGSKKMTPIIQLLPPPPKTLAEKRNRLEQVLARLMQKLALNPNALPVVDISYLLTGRGAR
LRRTNNSTPVPII
NT seq 10842 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgtgaaaagcaatacagcagacgcggctggcaccaatccggcggacaatgcc
aaatcgccgctctcttcgtcgtcatcgtcctcgtcatcctccgattcggacgatggctcg
gactcgtcgagcgattccgactcgtcgtcggcgtccacgagcaaaaccagcagcaaacag
agcagcggcggaggaggaggaggagtgccaccagaaaaaccacaacaatttagtgttatg
agttccgatagtgccggacttcgaatgaaaatagccattcctcgaagccaatcgaacgcg
acaccaacgccttcaccgacggcgtcgctcggttccaaccatcagcaccagcagctgatg
caacaggacagccttcctgccggcggcggagcagcagcagtagcagctgatcgaaggcag
aaaaatgcggaaaacgttctcggcggcgaacgcgcatcgcccgccggatcctccacgaaa
gtggattcgttcaaggacggcgccacgaagaaaggatccaatacagcaaagagtgccatg
gtggcggcggtggaggcgagttcaactcgcgctagagcacctccaaccgcccaacagcgc
gtgtcgagcgaaggcggtggtagcaaagcgttaacggcaacggctgcctcgcgcaagcag
ggcagtagaatgctgcccgacgacaaacgggaagagcggggcagaacgatgcacaccaag
gctaggaagcgtcggtcgtcgtcgggcaacgatggcagcagtgcgggtcgcacgaagaaa
agcgtcagtgaaagtgattccagttcggccagctcgtccttctcgtcctgcacgagcaac
agcgatagcgacacgagcagtaccgctggcgacaacagcaatcatcatcagcagcagcag
gacgataaggcgaagcaaacggtgggtgggggacgccatgcaaggacagcgtcgtcagcg
gcggtcgcgtctgggagtgctatcgcagctggcaaaaagcagaaaattctcaagcgaaag
aaggccagccgaaccgctacatccagcagtagcgatgaggaggacgaggaagatctgccc
agcgggcgcagcgggagcaagagcggtacggcgaaccggacaaacgagttcacctcgtcc
gactcgagctcctcagacgaggacggcaaagcattcgcggcaatgcgaacgaaagcgaag
agcttacagtcgacgaaaggcagcggcaaggacggcaatggtctgctaacgttgaccgat
ggcagtgcaggggggctgctgctgaaccggccacccctctccacgtccacaccggccaaa
cagcacggtgcgtttccaccgacactcggcggtggcatgtcgtcggccggggacggtggg
ctgacggccgagggcggttcctgttcgagcgacaacgagcttccggcgctagtcagtgca
gccattcggcgggtggaaagtggttccgatgccgaaagtatccgggggttgtccgccccg
acgcaacagtacacgtccagcctgttgcgggatttcgtcgtaaagacgcaaatgcttggc
acggttggtggcggcggcgcgggagcgatgccggcgggtgtgagcggatcggctgccaac
agtgccggtggtggcggtggtggaggtggttcgccatcctcatcctcctcgtcgtcatcg
tcgtcaggctcgtcctcgtcgtcttcctcttcctccatggaggaaggtgcagacccagcg
ataggaagcgccggtccaggcccgggaggtggtggtggtggtggagtggcagcatttgag
ttggatgtccgcaaaattaagactgaatctcccgtaccttcaacgttaccgcctgcttcg
gtgggccgtaacactccgctagtaaatgggcttaccaccgggggcatgaaaacgacggac
ctgccggtaccagccccggcaccgaaacgtcgtggtcgtcctccaaaatcaagcttgcaa
gcagcacccgccccgccacccgcagcccgaccgaccggttcgtcccggtcggtcaccatt
ccgaccgttagcgagtcgcccgactcgggcattctgtccacgcacagctccaccggttca
ccgaagacggataaaacgaggtcggcgtctcacctgcgatcgacggtgggagcgaccggt
tcgtccacctcatcgcgccgcagcaaatcggaagctcggggaagcgcttcgagtgcctcg
agtgccatactgtcggccggtggagcggcgtacgctgcaaactcggtcctacccgcgcca
ccgggagccgccgggagcggaagccgaacgtccggcgccgccgcgtcgtcctacgcgctc
acctcctgtcttgatcgcaacacgtacgctaccgagcgcgtcctgtatcctccccggggg
ccgaagaaacggggcgtcgggagaccgccgaagaaggacacgacagcgcatcagcagcca
gccggcgccggacggggaggctctgcgaacgatccggccgcccggtcgcagcagcaagcc
gaagatcggctcgatccgcactggcagaagatcgatattagcaaaaagtttcacgaacca
cggctcagcgggtacaagagcgacggtggccattcgacgatctgctgcagcaagcggctt
gcctcgcagagcggctacatcagcgactatggcggcgttggagcgagcagtgggcgcagc
cggctgtccggctacaagtcggactttagctctcgctcgaggcgcagctgcagccgggcg
ggaggctaccgcagcgactacgggcgggcgaagagctgcggctatcgcagcgactgcagc
acgcggcatcgcaaacaggtgcggcgaaaacggcgcaagaaaataggcagccatcagcag
tcgcagcagcagcaccataaccagcacgaccaacagcatcacaacaacaatctcagcgat
cggaaaaactacaacgcgtcgagcgatgggggcggcggtggtggtagcaccaaatcggcc
agcgttggcgagctggaaataatgttcatggcggggttaacgctgggtagtacgagcgac
gaagatagcagcagcacgagcagcagtacgagcagcagcagtgccgagagtcgcgagagc
ttattcacggaccattccggtgtggatcgtggtgcgaacagcagcagcggagcggacaag
gtgaagcgagcaacgtctggcaggggaagaaaagcgaacgtggctaccaccaaaccgaac
gcaaagcttccgcgaacgcctcgaaaacccaccccgccgaaaacagtcgcaaaagggcgt
ggagccgcaaaagctccccgaggcagaccgccctccagcacgacgatcgatcggagaagg
aaagcgaatcacgcaaagcacggcagcaacaagctcgactcggacgatgaggacgaggac
gaggaagaagaggcagagttggtggtaaagcgacggtttggtgaccgcgtccggaccaaa
ccactgcagcccgccccgaaagacccaccgacgaagccttcggtcgctgcgactgcttcc
gtcgcgctcaagcaaaagtcgtccgcgttggtgaagaaaccgggccagcgtggtcgacca
ccaggcgtgaaaaagcaaccgggtgggacgggaagtacggccacagccgccgccctgccc
gccggcaaaacgctcggaagtttggacgttctgctcgcgccgaagaatagcaccgctccc
gtgctgccggtcaacaacttcgaccgggtagttgcgtcgatgagtggcagcagcagcggc
aagcagcagcccggatcgagcgaagcgaaaaaatcctccatctacaccttctccagcacg
accgtcgcgccgaagaacgcttttgccgcgtttctgctgcgtggtgcggcggccgacgac
gcgtccaaggacgacgcggaggaaggcggccggctgctgggggtcaagaagcttcccctc
tcgaaagcgaacgtgatcaagaactcggaggagtgcagtcggcggtttcagaagtccacg
tcctcgtttgcgctcggcggcattgccggttcggtcgacctgctggcgcgcattgccgac
gggacgatcccgaaggcatcgcccaccaagtcggtctgctcgaagcgcagccgaaggaag
agctgcgccagcgaccggctggaggtaatgtcggtcaagagctacggtgtgatcggcagc
tgcggcaagatacgccagcggcgcctgagcacgatgagccggtgcagcagtcgttcggcc
ggctcgaggcatgcggcggccaggatgaggcggcgcaaaaagcggctacgttcgatgtcg
gtggcacccggcactacggcggagatggtaagcgggggtggcggtggtagtggtcatgct
gctggtggtgcgcccagttcgtccggcctcgatttgaagctgaacgttgagatcgatcgg
ctgagtgaaagcttcagtggcatgtgtcgcattgtgggtggaacggttaacaatgaagct
ggccaagcatcgtccggcgctggccgatcagtaagcccaccggaggagacaacggccacg
aatgcacctgccgccgcaacaccaacatcgggcaagggacaccaaaccaagcgctcggtg
aagaaacggaaagcgtccgagcatgtgacggactccccctcgacagcgggtggggcaaat
gcaccgggcggtggtggtggaggtgccgctgcgctaggcaatggtggcggagccggcggt
ggtggcggtacgggcaagcggcggaacaagaaaaccgtcccaacgcagagcccggacgat
cacaaacttccgctcaagaaacggcactacctgttgactcctggcgagaaaggcaacaac
agtgacaacaacagtggagtggatgaagtgaagaccggtagtagtgggggaaacggtggt
ggtgttggtggtagtagcgctactgccgctggaagtaacgtcgatagtggaaatagttct
acgagtggcgctacggggtccggttccgggtcagccaattccagcttcaccggcagccat
accgtgttgaacccgtgcgcctttgccagtggcgcgagatcatcggccaactcggcagcg
gctgggtcttccatctcgggtgcagccaccaaggcggtgacgcccaagaaacggcatcta
ctgaaatctcccgaacccggtcccgtcccgaccgacaccgagctgcagctgcagattaag
tcgagcgattctccgctgacgatcgtgaatggaggtggagcgtcgggcacggtgggcgat
gcaggaagctctccatcggacggacataccgttggtcgaaaggcggctgttgatggcgct
gttggtggaagtccctctaatgctgctggacaagcgaatcctcctgtggctggaagcaag
aaaaagaccaatcgccagcaggaaggatcgtcgatttcgtcctcgaccgtcagtcgggag
cggcaagcaacgggagcttccggtcaacccggtacaacgagtgacaattcagccgggccc
caacatcgttcaacgccaccggcacggccatcggttatacaatcgtccggatcggtgcat
cctgccgcctcttctggtgcgtattccgcctcgtctgccggaccaccgccaggagtgttt
gagccaacggtcgatctggagctggtgataccgccaccctcttccataccgtcgcttatc
gcaaaggttgaaatgctcgattcgcctcgcttgggtggcaaagacgttgctgctgccgcc
ggtgccattgggtcctcctcctctggctcctcgggcaatgtggccaccaagctggaatcg
gaggaactgcaggtgctgacggctgcccagcgaaaagcggccgggctgggagcgggcagc
gcattgctggcgaccatctcgaccgcatccgcctcctccgagaaggtgctggagaagctg
ctcaccaaaaccggcgcccatcatctgctgatgaagaaaaagcgcaaaaagcccaatcgc
actggctttcccacggtgaagaagaagaagaagaagctgccggagaatgaccctctggac
gatgggctgtcggtgctggatttgaagcctgaagtcgggccggatctgttcgattcgtcc
aacctaacgcgccacgtaccgtccgaggcggaaaagacgcgtatgaaggaaaggcagcag
cagcaccaccctactacaggaaagcatgcggcgtgcgatcgcgtaccgaaggagggcgaa
ccgacggactgctttatcgagcgacacacgggcgttgggcgacctcgactgtccgtggta
agcctggagaagctgcagggcaagctgcctctaccgggaggaggttctcgcgacgttgca
acgacaccgccggcgacgggaggccgtggccgtaagtccgtgataaacccactggcagcg
gagcatcagttggcggcacatcgctcgagaggactcagagacgaaccgccggcagcagcg
gccggcacagtaggtcgcaaaggcaagaagagacaggaagcaccgaagccactgcccgag
actgcagtcggtaagcgtcagaaggcctcgatggacacggaaattcgatcggcaaaggag
cgaaaccgtagcaagagtgtgtcggttgcgtcggagcaactgcccaacattgtgcggctg
agcgaaaccctgtccaagggtgccgcggctaaggaaaacaaggaaaacagccgtctacca
cccgggaggcctccttcggcagcaaagcgagccggcaaagaacccgccacgagtgcggaa
acatcgccgcaagatgatgccgccggagtcattcgtcgaacgcgcagctcctcggtggcg
ctggatccgtccgaggtgaagaaactgcaccaccatcaccaccaacaacacgatgcagag
cacgagtcggccggaaagggagcgtcccagtccagcacaccggtgcgtccccattccggc
ggaattgccgcactgcacaacgaggactccacgtctttggactcgatgccactgctgaag
cgcctccattcgcgctccatctcgcgcatgcagtcggtcatcacaccgacggtggtgatc
gaaccgattgccacctcgccgaagacacccggccgaccgaggggccggccgcgcacaacc
tcacccattacggcaacggaaacgcccaactcgcccaccgccactaccgggcccggtcgt
ggacggcctcggacggcgctcgccctcactggcaacccttcggcagcgtccatgcagcgt
acgcccgcctctccgctctcctcgcccagcccgacggtggccgcggccgagcgcaccgct
ggcagaaagaagcagcgattagacggtcgcaaatcggtgcctcccggccttgccgaaccg
atcgaaagcgctcgtctcgcgaccagagtgacggcatccaagtcggtcacgccgacgcct
ccggtgggaaccgtcattccgacacggttgaagcgcggcaaaagcgatgaaacgctgcga
gcccaacagcttgaaaagcccaccaagaagccgcgaaaggagttgccgggctcggccgaa
ccatcgccggaaacggcagcccatctgtccaagcgatcggccatcgtgtctcccatcgtc
gagccggtcgatccggaggaaacggcccacgtgctgcagccggccagctcgacggaggag
ctggagcacgatccgctcccaccggacgagggaccgtcggatttcctccggctcaccgac
accccctcgccgacgtcttccggtgaagcgcgggagcttgcgatgggtggtgctgcggcc
gccggtggccgtggtgccggcacgagcaagaagctgccccgcaagaagtacattacggcg
ggcctgttctccgactgctacaaggacgacggtacgacgggcggggagggccgttcgggg
ccgaaaacgcccccggaaacgctgctccctccgccggcctactgcgagcggttcctgcgc
cgtacggtgcgcgacttccagctgccgtacgatctctggtggctgcaggagaacggcaag
ctgcccggccgcaactcggtgccgagctggaactatcgcaagatccgcacgaacgtgtac
tacgacgtcaaggcgaacccgtcgaccgacaacaacacgcagtgcaactgcaaaccggac
agcggctgccaggacgactgcctcaaccggatggtgtacacggagtgcgtgccggagcag
tgcccgtgcggcgaccggtgccgcaacacgtgcatccagcggcacgagtacgcgcccggg
ctggagcgcttcatgacggaggagaagggctggggcatccggtcgcgggagcgcatcagc
aagggcaccttcatcatggagtacctcggcgaggtggtgaccgagcgggagtttaaggag
cgcatgcgcacgatgtacctgaacgacacgcaccactactgtctcaacctggacggtggt
ttggtgatcgacggccatcggatgggcagcgactgtcgcttcgtcaaccattcctgcgca
ccgaactgcgagatgcagaagtggtccgtgaacgggctgttccggatggcgctgttcgct
atgcgtgacattccgccgaacgaggagctttgctacgattacaacttcagcctgttcaat
ccctccgaggggcaaccgtgccgctgtggctcggaacagtgccgtggggtgattgggggc
aaatcgcagcgcatcaaaccgatcccgctcggttcttcgggtggcggcgccagtggccct
ggaggcaccggtggccaacgaaatgcttccgaagcgggtgcggacacagatgcgagcaaa
gcggccggagccgatggtacggcgggtggcaatggagcgagtggggcgctggtggtcgag
ttgagtccacggagtgcggcccgatcgcgcaaacggcaggcgaagaagaaccaaccgatt
gtgcacctgaacggtacgcctctgcccacgttccatccaccgtcggtcaaggagcgggca
ctgatcgccgagcatcattgctttttgctgcgcaatctcaacaaaatccgcaggcagaag
gaacgagccgcgacactcgcatcggccggcggcggtggaaatggtggagcgggtgcagct
gcgaccgagagcggcggccagggagcggctgcgggaagtgatcagacagcgggcgggtcg
ggtaaaccgtcgcttgcgtcgcaaatctccgccttgcgctgtccgcgcaacattcgcacc
cgtgggctcgcctttgtcgaggacgatccggagctggagaagacggcccgcattgcggtg
gcgctaaaggatatttgcaccgaaattgccaccttgaaagatgataaaggagtgccgttt
atcagcaaacttcagttgccatcgaagaagaagacgcccctgtactacgagcgcatcccg
aaaccgatcgatctggcgcagatcgagaccaacatcgagcagggcgtgtaccgcatgccg
aaggtgttcgaggaagatctgctgatcatgctgagcaacgcgatcaagtactacggcatc
aactcgccggaagggatcgcctcggaagcgctcaaatcgcactactacacctgcaagcag
cagcaggtaccgaagctgcaggcgtacatcggcgaagaaaatgagctgctgcgcgggttc
gtgccgaagaaggaaccggccgaggatgcggtgccgccgaaaccgaagcgcggccgtcgc
caggagcaaccggaagacattatccgctgcatctgcgggctgttcaaggacgagggtttg
atgatccagtgctccaagtgtctcgtgtggcagcacatcgagtgcaccaaggcggacccg
gcggtcgagaactatctgtgcgaaaagtgcgatccgcgcgaggtaaactacgagattccg
ctgaacgagttcacggaggagggctaccagtactacgtgtcgctgatgcgcggcaagctg
cagatccgccagaccgacacggtgtacgtgctgcgcgacatcccgatgtcgcccgatccg
aagaacccgaacgcgccggtccgcaagcacacgtacgaaacgatcggcaagatcgagtac
agcgagtgtgacatctttcgcgtggaaagcctgtggaaggacaaggaggggcggcgcttt
gtgtacgggcatcactatctgcggccgcacgagacgtaccacgagccgacgcgccgcttc
tacccgaacgaggtgatgcgcgtgccgctgtacgaggtgataccgatcgagctggtggtg
gaccggtgctgggtgctcgacccgatcacgttctgcaagggccggccggtcgacagctcc
gagccgcacgtgtacatctgcgagctgcgcgtcgacaagagtgcgcggctgttttcgaag
atttcgcgccactcgcacccggtgtgcatgaaatcgtacgcgttccacaagttcgagcag
aagctcaagatagccaaaacgtttgcgccgcatgatcttggttcgctggctcatctactg
tcaatacgggacaagcaaaagaagggttcgaagaaggacgacggtagtggtggacaaacg
tcggccggatccgctgccggcgggtcgtccggtttcggcggtgccggcggaagccattcc
ggtggttcgaagaagatgacaccgatcatacagctgttgccaccgccaccgaagacgcta
gcggaaaagcgcaaccgactggagcaggtactggcacggctgatgcaaaagctagcgctc
aacccgaacgccctgccggtggtggacatatcgtacctgctgacgggacgcggggcacga
ctgcgacggaccaacaactcgacgccggtgccgattatttga

DBGET integrated database retrieval system