KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001649Help
Entry
AgaP_AGAP001649   CDS       T01036                                 

Definition
AGAP001649-PA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aga00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aga00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 537 aa AA seqDB search
MRCCDRVPVMVVSSLALCGVLLLALSHTPLVTADGLPCALRQYPNGAVCVCNATYCDTLE
YREPTELGSFLLVSSSSGGLRFAQTEGNFSRTAKQQRPIRAEADVTITLDPLRRYQRVEG
FGGAFTGAVSHNLGRLNPALRESLYKAYYSPTQGIAYRFMRVPIGGCDFDLAPWAYNELP
VNDAALSNFTRLDERDLVKVAQIKELMNVTGNGEIRLIGAAWSPPPWMKTNNDWTGASRL
RPEYYQTWADYHVRYLELMRAAGLNFWAISTGNEPLNGVIGFLFVHFMSLGWIAQDQGRW
VGENLGPALRASAVSEVKLFGCDDQRYTFPLWFKLMDEGHPNATRYLDGLAVHWYWDGVA
PAALLDQTAARYPDKWIFNTEASLGDKPLQQHRPILGSWERAESYIVYVMQDLQHSVHGW
IDWNLVLDERGGPNYADNFVESAVIVNGTSWEEAYKQPIFYGLGHFSRFILPGSVRLEVQ
SSSGDVQVIAFERPDKRTVLVMYNRANWKSSVRIEDKRYGSVRVRLPPKSVHTMLYL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttgcgatcgtgttccggtgatggtggtgagcagtttggcgctgtgtggtgtg
ctgctgctcgcattgtctcacacaccattggttacggcagacggattgccctgcgccttg
cggcagtatccgaacggagcggtgtgcgtgtgcaatgcgacgtactgcgatacgctcgag
taccgtgagccgacggagctgggcagctttctgctggtgtccagcagcagtggcgggctg
cgcttcgcccaaaccgagggcaacttctcgcgcactgccaaacagcagcggccgatccgt
gcggaagcggacgtcacgatcacgctcgacccgttgcggcgctaccagcgggtggaaggt
ttcggtggcgcgtttaccggcgcagtgtcgcacaatctgggccggctgaacccggcgctg
cgcgaaagcctgtacaaagcgtactactcgccgacgcaggggattgcgtaccggtttatg
cgcgtaccgatcggtggctgtgattttgacctggcaccgtgggcgtacaacgagctgccg
gtgaacgatgcagccctgtccaacttcacccggctggatgagcgcgatctggtgaaggtg
gcccagatcaaggagctgatgaacgtgacgggtaacggcgagatacggctgatcggtgcc
gcctggagtccgccgccgtggatgaaaacgaacaacgattggacgggcgccagccggcta
cgacccgagtactaccagacgtgggccgactatcacgtgcgctatctggagctgatgcgt
gccgccgggctaaacttttgggccatctcgaccggcaacgaaccgctgaacggtgtgatc
ggcttcctgtttgtgcacttcatgagcctgggctggattgcgcaggaccagggccgctgg
gtgggagagaacctcggcccggcgctccgcgcttccgccgtcagtgaggtgaagctgttc
gggtgcgacgatcagcggtacacgttcccgctgtggttcaagctgatggacgagggccac
ccgaacgcgacgcgctacctggacgggctggccgtccactggtactgggacggtgtggcg
ccggccgccctgctcgaccagaccgccgcccgctatccggacaagtggatcttcaacacg
gaagcctcgctgggcgacaagccactgcagcagcatcggcccatcctggggtcgtgggag
cgggccgaatcgtacatcgtgtacgtgatgcaggacctgcagcacagtgtgcacggatgg
atcgattggaatctggtgctcgatgagcggggcggtccgaactatgcggacaactttgtc
gagagtgcggtgattgtgaacggaacgtcctgggaggaagcgtacaagcagccgatattc
tacgggctgggacacttttcacgcttcatactgcccggctcggtgcggctggaggtgcag
tcgtccagcggcgatgtgcaggtcattgcatttgagcggcccgacaagcgcacggtgctc
gtaatgtacaaccgagccaactggaaatcaagcgtccgcatagaggataagcggtacggc
agtgtgcgggtacgtcttccacccaaatcggtacatacgatgctctacctataa

DBGET integrated database retrieval system