KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001684Help
Entry
AgaP_AGAP001684   CDS       T01036                                 

Definition
(RefSeq) AGAP001684-PA
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00730  Thiamine metabolism
aga00790  Folate biosynthesis
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AgaP_AGAP001684
   00790 Folate biosynthesis
    AgaP_AGAP001684
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AgaP_AGAP001684
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP001684
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aga00537]
 Enzymes
  AgaP_AGAP001684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 1281493
NCBI-ProteinID: XP_321411
VectorBase: AGAP001684
UniProt: Q7PY02
Position
2R
AA seq 548 aa AA seqDB search
MLYRLLCVYLALVGGLVSTSPLHHEAEEEYDPMHPQRFLFADLAPTASTDQRAKRSSASM
PKLRFEPPSPNEQHAQYWNNVAQDILDRQLHKNRLNRKVAKNVIMFLGDGLSIPTLAATR
VYLGDESTELSFERFPYVGLSKTYCANVQVADSACTATAYLAGVKANYGTIGLTAAAALG
DCQAQNDTSNHVHSIAKWAQDAGLSTGFVTTTEVTNASPAGMYAHTANRNWEYNGAIEKD
GFDPAVCQDIASQLIHGEVGKHMRVIMGGGRREFLPTHETDIDGIRGRRTDGEDLIKHWQ
HHHSHHRSAYVQNRVQLLETNTAHGETDYLLGLFSSKHLPYHLDADEQQIPTLSEMVSTA
MDILERNDNGYFLFVEGGRIDHGHHYTQPIRAFDETVEFAKAIEMARSRTSQDNTLIVVT
ADHSHTMTMSGYSSRKNDILGVNNGQRADDELPYATISYANGPGYDRNVQREARLDLNRV
DMRDKSFAFPSTVPLGLETHGGDDVAVFASGPWAHLFSGTYEQHFIPHAMAYAGCIGPGR
TACTEQQS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgctgtaccggctgctgtgcgtctatctagctttggtcggtggcctagtttcgacgtca
ccattgcaccatgaagctgaggaagaatacgacccaatgcatccccagcggtttctgttc
gcggatctggcgccaacagcatctaccgaccagcgcgccaagcgctcgtccgcatcgatg
cctaaactgcgcttcgagcctccatccccgaacgagcagcatgcccagtactggaacaac
gtggcacaggacatactcgaccggcagctgcacaagaacaggctgaaccggaaggtggcc
aagaatgtaatcatgttcctgggtgatggactctccatcccaacgctggccgcaacgcgc
gtctacctcggtgacgaaagcacggagctgtcgtttgagcggttcccgtacgtgggactt
tccaagacatactgcgccaatgtacaggttgctgattcggcctgcaccgcaactgcctac
ctggccggagtgaaggctaactacggaaccatcggccttacggccgcggctgccctcggg
gactgtcaagcgcagaacgatacctccaaccatgtacattcgattgcaaaatgggcccag
gacgctgggctttctaccggattcgtaacgaccacggaagtgacgaatgcttccccagct
gggatgtatgcccacacggccaatcgaaactgggagtataacggtgccatcgagaaggac
ggctttgatcctgccgtttgccaagatattgcctcccaacttatccatggcgaggtcggc
aaacatatgcgagttattatgggcggaggtcgtcgggagttcctgccaacccacgaaacc
gacattgacggcatccggggaaggcgcaccgatggagaggatttaattaaacactggcaa
catcatcattcccatcaccgatctgcatacgtgcagaaccgtgtccaattactcgagacc
aacactgcgcacggtgagacggactatttgcttggcctgtttagcagcaagcatcttccc
taccatctggacgcggacgaacagcagatccccacgctgtccgagatggtatcaaccgcg
atggacatcctcgagcgcaacgacaatggatactttctatttgtggaaggcggccggatt
gatcatgggcatcattacacacagccgataagagcgttcgacgagacggtcgagttcgct
aaagctatcgagatggcacgcagccgcacgagccaggataatacactgattgtcgtaacg
gcggaccactcgcacacgatgacgatgagcggttactcgagtcgcaaaaatgacatactc
ggagttaataatggccagcgggcggatgatgagctgccgtacgccaccatcagctacgcg
aacggacctggttacgatcggaacgtgcagcgcgaagcccggctcgacctgaaccgggtc
gacatgcgggacaaatcgttcgcctttccgagcaccgtaccgctcgggctggaaacacac
ggcggtgacgatgtggccgtatttgccagcggtccttgggcgcatctgttcagcggtacc
tacgagcagcatttcatcccgcacgcgatggcctacgccgggtgcattggaccgggtcgt
acggcctgcactgagcagcaatcgtaa

DBGET integrated database retrieval system