KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001736Help
Entry
AgaP_AGAP001736   CDS       T01036                                 

Definition
AGAP001736-PA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 361 aa AA seqDB search
MCFRLNSTASADQSSMSSGTDEDDKEDEAAGGKLTAELPIGRDRIPIVYRPEYGVRFLGL
QKLHPFDAAKGGNIYRLLKTNGLIQTDGDVYAPNEITLEELLAVHTQRYIDSLKWSLNVA
KIAEIPPLLFVPNCFVQRSYLRPMRYQTGGSLLAARAALESGLGWAINLGGGFHHCSADR
GGGFCPYADITLAVKMLQSSGKGIERILIVDLDAHQGNGYERDLMEDRRVFILDMYNYRI
YPRDQHAKLAIRRAVELKPHTDDEEYLRKLKHCLSQSIAEFEPNFIIYNAGTDILKGDPL
GLLDITPEGVVERDEFVFRSALERSIPLVMLLSGGYLRSSARVIANSIVNLRDKALLPTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttccgattaaacagtacggccagtgcggaccagagctctatgagcagcggaacg
gacgaggacgataaggaagatgaggctgcgggtggaaagcttaccgccgagctgccaatt
ggccgtgaccggataccgatcgtttatcggcccgagtatggtgtacggtttctcggcctc
cagaagctgcacccattcgatgcggccaagggaggcaacatctatcggctgctgaagacg
aacgggttgatacaaaccgacggggatgtgtacgcgcctaacgaaatcacgctcgaggag
ctgttggccgttcatacgcagcgttacatcgacagcctgaagtggagtttaaatgtggcc
aaaatcgccgaaataccgccgctcctgttcgtgccaaactgtttcgtgcagcgaagctat
ctgcgcccgatgcgctaccaaacgggcggctcactactggcggcccgtgccgccctcgag
tccgggctgggctgggccatcaatttgggcggtgggttccatcactgcagtgccgaccgg
ggcggtgggttctgcccgtacgccgacattacgctggcggtgaaaatgctgcaatcgagc
ggcaagggcatcgagcgcatcctgatagtggatctcgacgcgcaccagggcaatgggtac
gagcgggatttgatggaggatcggcgcgtgttcatcctggacatgtacaactatcgcatc
tacccgcgggatcagcacgccaaactggcgatacggagggcggtcgagctgaagccccac
acggacgacgaggagtacctacggaagctgaagcactgcttaagtcaatcgattgcggaa
tttgagccgaactttatcatctacaacgccggcaccgacatcctgaagggtgatccgctg
ggcctgctagacatcacgcccgagggtgtggtggagcgggatgagtttgtgtttcgcagc
gcgctggaacgctccatcccgctggtgatgctgctgagcggtggatatttgcgcagctcg
gcacgtgtcatagccaactcgatcgtgaacttgcgcgacaaagctttgctgccaacggtc
cagtag

DBGET integrated database retrieval system