KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001736Help
Entry
AgaP_AGAP001736   CDS       T01036                                 

Definition
(RefSeq) AGAP001736-PA
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AgaP_AGAP001736
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     AgaP_AGAP001736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DUF2584
Motif
Other DBs
NCBI-GeneID: 1281439
NCBI-ProteinID: XP_321350
VectorBase: AGAP001736
UniProt: Q7PY40
Position
2R
AA seq 361 aa AA seqDB search
MCFRLNSTASADQSSMSSGTDEDDKEDEAAGGKLTAELPIGRDRIPIVYRPEYGVRFLGL
QKLHPFDAAKGGNIYRLLKTNGLIQTDGDVYAPNEITLEELLAVHTQRYIDSLKWSLNVA
KIAEIPPLLFVPNCFVQRSYLRPMRYQTGGSLLAARAALESGLGWAINLGGGFHHCSADR
GGGFCPYADITLAVKMLQSSGKGIERILIVDLDAHQGNGYERDLMEDRRVFILDMYNYRI
YPRDQHAKLAIRRAVELKPHTDDEEYLRKLKHCLSQSIAEFEPNFIIYNAGTDILKGDPL
GLLDITPEGVVERDEFVFRSALERSIPLVMLLSGGYLRSSARVIANSIVNLRDKALLPTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttccgattaaacagtacggccagtgcggaccagagctctatgagcagcggaacg
gacgaggacgataaggaagatgaggctgcgggtggaaagcttaccgccgagctgccaatt
ggccgtgaccggataccgatcgtttatcggcccgagtatggtgtacggtttctcggcctc
cagaagctgcacccattcgatgcggccaagggaggcaacatctatcggctgctgaagacg
aacgggttgatacaaaccgacggggatgtgtacgcgcctaacgaaatcacgctcgaggag
ctgttggccgttcatacgcagcgttacatcgacagcctgaagtggagtttaaatgtggcc
aaaatcgccgaaataccgccgctcctgttcgtgccaaactgtttcgtgcagcgaagctat
ctgcgcccgatgcgctaccaaacgggcggctcactactggcggcccgtgccgccctcgag
tccgggctgggctgggccatcaatttgggcggtgggttccatcactgcagtgccgaccgg
ggcggtgggttctgcccgtacgccgacattacgctggcggtgaaaatgctgcaatcgagc
ggcaagggcatcgagcgcatcctgatagtggatctcgacgcgcaccagggcaatgggtac
gagcgggatttgatggaggatcggcgcgtgttcatcctggacatgtacaactatcgcatc
tacccgcgggatcagcacgccaaactggcgatacggagggcggtcgagctgaagccccac
acggacgacgaggagtacctacggaagctgaagcactgcttaagtcaatcgattgcggaa
tttgagccgaactttatcatctacaacgccggcaccgacatcctgaagggtgatccgctg
ggcctgctagacatcacgcccgagggtgtggtggagcgggatgagtttgtgtttcgcagc
gcgctggaacgctccatcccgctggtgatgctgctgagcggtggatatttgcgcagctcg
gcacgtgtcatagccaactcgatcgtgaacttgcgcgacaaagctttgctgccaacggtc
cagtag

DBGET integrated database retrieval system