KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001760Help
Entry
AgaP_AGAP001760   CDS       T01036                                 

Definition
AGAP001760-PA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
aga  Anopheles gambiae (mosquito)
Brite
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AgaP_AGAP001760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 189 aa AA seqDB search
MGNKSSLLLREEEIAQIHEETGFTPNQIERLYSRFTSLDRNDCGTLSREDFLRIPELAIN
PLCERIVHSFFADSNDDRVNFRQFTRVLAHFRPIKPNKENRLNSREEKLRFAFKMYDLDD
DETISRDELLNILQMMVGANISQDQLNSIAERTIVEADTVGVGKISFDDFCRALERTEVE
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaaatcgtccctgttgctgcgtgaggaggagattgcccaaatccacgaggag
actggctttacaccaaaccagatagagcggctgtactcccgcttcacctcgctggatcgc
aacgactgcggtacgctttcgcgggaggacttcctgcgcattcccgagctggcgatcaat
ccgctgtgcgagcgcatcgtgcactccttctttgccgacagcaacgacgatcgggtcaac
ttccgccagttcacgcgcgtcctcgcccacttccggccgatcaagccgaacaaggagaac
cggctgaacagccgggaggagaagctgcggttcgccttcaagatgtacgacctggacgac
gatgagacgatctcgcgcgacgagctgctcaacatcctgcagatgatggtcggggcgaac
attagccaggaccagctgaacagcatcgcggagcgcacgatcgtggaagcggacacggtc
ggcgtgggcaagatttcgttcgacgacttttgccgcgccctggagcgcacggaggtggag
cagaagatgtcgatccgcttcctgaactaa

DBGET integrated database retrieval system