KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001793Help
Entry
AgaP_AGAP001793   CDS       T01036                                 

Definition
AGAP001793-PA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AgaP_AGAP001793
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   AgaP_AGAP001793
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AgaP_AGAP001793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 404 aa AA seqDB search
MACNKENRKLLNGPSSVAASTGIPSHSGTLLVKKGAGVGGPAANTAAGRSNNAAKMVGKV
AEGGGQHMGGFKAPQLPAPVVRPAASSSKPVPEKQITPKTESEPMDTTPADDRPDAAEQK
QSGTDGNQQAQQAKPAKKVWTLSNFDIGRPLGRGKFGNVYLAREKETKFVIALKVLFKKQ
VHAQGIEHQVRREIEIQSHLRHPNILRMYGYFHDESRIYLILEYAPGGTLFKEQQQQPGK
RFPEKRCAIYVYSLVSALIYLHERNVIHRDIKPENLLLGHGGELKIADFGWSVHEPTSSR
TTLCGTLDYLSPEMVQGQPHTKTVDLWSLGVLAYELLCGKAPFLATTYEETYRKIMKVQY
TVPPDVTKAASHLISRLLVKDPASRMPLENVAIHPWIQLHVDKK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcaacaaagaaaaccgtaaactactgaacggaccgtcatcggtagccgcgagc
acaggcattccttcccattcagggacgttgctggtcaaaaagggtgccggtgttggaggt
ccagccgcaaacacggccgcaggaaggagcaacaatgctgcgaagatggtcgggaaggta
gcggaagggggaggacagcatatgggaggcttcaaagcacctcagctgccggcacctgtg
gtgcggccagcggccagtagcagtaaaccagtgcccgaaaagcaaatcactccaaagact
gagtccgaaccgatggatacgacgccagccgatgataggccggatgcggcagagcagaag
caaagcggcacggacggtaaccaacaggcgcaacaggcaaaaccggccaaaaaggtgtgg
acactcagcaatttcgatatcggccgtccgctgggtaggggcaagtttggcaatgtatat
ctggcccgcgaaaaggaaaccaagttcgtgatcgcgctgaaggtgttgttcaaaaagcag
gtgcacgcccaggggatcgagcatcaggtgcggagagaaatcgaaatacagtcccatctg
cgccatccgaacatactgcgcatgtacggctactttcacgacgaatcgcgcatctatctc
atcctggagtatgcgccgggcggtaccctgttcaaggagcagcagcagcagccgggcaaa
cggtttcccgagaagcggtgcgccatctacgtgtactcgctcgtgtcggcgctgatctat
ctgcacgagcgcaatgtgatacatcgggacataaagccggaaaacttgctgctggggcat
ggtggtgagttgaagatagccgatttcggttggtccgtacacgagcccacgtcgtcccgt
acgacgctgtgtggtacgctcgactatctgtcgcccgagatggtgcaaggtcagccgcac
accaaaaccgttgatctgtggagcttgggcgtgctggcgtacgagctgctgtgcggaaag
gccccgttcctggccaccacgtacgaggaaacgtaccgtaagattatgaaggtgcagtac
acggtgccgccggacgtgacgaaggcggcgtctcatctgatctcgcgactgctcgtcaaa
gatccggccagccgtatgccgctggaaaatgtggccatccatccgtggattcagctgcac
gtggacaaaaagtga

DBGET integrated database retrieval system