KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001799Help
Entry
AgaP_AGAP001799   CDS       T01036                                 

Definition
AGAP001799-PB
Orthology
K10373  
tropomyosin 1
Organism
aga  Anopheles gambiae (mosquito)
Brite
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   AgaP_AGAP001799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKIEKDNAQDKADTCENQAKEANLRADKIMEEVADLTKRLEQVTQDHEKF
KASLEQATKDSEEKDKLLTSTEANVAALTRKVQQVEEDLEKSEERSSAALSKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE
NAEKNVKKLQKEVDRLEDELGVNKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaaaatgcaggcgatgaagatcgagaaggataacgcgcaggac
aaagccgacacctgcgagaaccaggcgaaggaggcgaacctgcgcgccgacaagatcatg
gaggaggtcgccgacctgaccaagcgtctggagcaggtcacccaggaccatgagaagttc
aaggctagcttggagcaggccaccaaggacagcgaggagaaggacaagctgctcacctcg
accgaggcgaacgtggccgccctgacccgcaaggtccagcaggttgaggaggatctggaa
aagtctgaggaacgttcgtccgccgcgctgtccaagctgctggaagctacccagtcggct
gatgagaacaaccgtatgtgcaaagtgttggagaaccgttcccagcaggatgaggagcgt
atggatcagctgtccaaccagctgaaggaggcgcgtatgctcgctgaagacgccgatacc
aagtccgacgaggtgtcccgcaagctggccttcgttgaagacgagctggaagtggctgag
gaccgtgtcaagtccggcgaggccaagatcatggagctggaggaggagttgaaggtcgtc
ggtaactccctgaagtctctggaggtgtcggaagacaaggccaaccagagagtggaggag
ttcaagcgccagctgaagagcctgacgatcaagctgaaggaggcggagacccgcgccgag
aacgcggagaagaacgtcaagaagctccagaaggaggtcgacagactagaagatgagctg
ggcgtcaacaaggaccgatacaagtccctggccgacgagatggactccacgttcgccgag
ttggccggctactaa

DBGET integrated database retrieval system