KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001799Help
Entry
AgaP_AGAP001799   CDS       T01036                                 

Definition
(RefSeq) AGAP001799-PB
  KO
K10373  tropomyosin 1
Organism
aga  Anopheles gambiae (mosquito)
Brite
Cytoskeleton proteins [BR:aga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     AgaP_AGAP001799
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   AgaP_AGAP001799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II DUF745 Laminin_I ATG16 WEMBL ERM EzrA Reo_sigmaC DUF3584 CENP-F_leu_zip HOOK DUF1664 BST2 Alanine_zipper FUSC DUF4201 ORF6C IFT57 BLOC1_2 VPS11_C FPP APG6 Myosin_tail_1 PspA_IM30 AAA_13 SlyX Noelin-1 Mnd1 CALCOCO1 CLZ Fez1 DUF4200 RmuC Lebercilin DUF724
Motif
Other DBs
NCBI-GeneID: 1281316
NCBI-ProteinID: XP_003435947
VectorBase: AGAP001799
UniProt: F5HME4
Position
2R
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKIEKDNAQDKADTCENQAKEANLRADKIMEEVADLTKRLEQVTQDHEKF
KASLEQATKDSEEKDKLLTSTEANVAALTRKVQQVEEDLEKSEERSSAALSKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE
NAEKNVKKLQKEVDRLEDELGVNKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcaagaagaaaatgcaggcgatgaagatcgagaaggataacgcgcaggac
aaagccgacacctgcgagaaccaggcgaaggaggcgaacctgcgcgccgacaagatcatg
gaggaggtcgccgacctgaccaagcgtctggagcaggtcacccaggaccatgagaagttc
aaggctagcttggagcaggccaccaaggacagcgaggagaaggacaagctgctcacctcg
accgaggcgaacgtggccgccctgacccgcaaggtccagcaggttgaggaggatctggaa
aagtctgaggaacgttcgtccgccgcgctgtccaagctgctggaagctacccagtcggct
gatgagaacaaccgtatgtgcaaagtgttggagaaccgttcccagcaggatgaggagcgt
atggatcagctgtccaaccagctgaaggaggcgcgtatgctcgctgaagacgccgatacc
aagtccgacgaggtgtcccgcaagctggccttcgttgaagacgagctggaagtggctgag
gaccgtgtcaagtccggcgaggccaagatcatggagctggaggaggagttgaaggtcgtc
ggtaactccctgaagtctctggaggtgtcggaagacaaggccaaccagagagtggaggag
ttcaagcgccagctgaagagcctgacgatcaagctgaaggaggcggagacccgcgccgag
aacgcggagaagaacgtcaagaagctccagaaggaggtcgacagactagaagatgagctg
ggcgtcaacaaggaccgatacaagtccctggccgacgagatggactccacgttcgccgag
ttggccggctactaa

DBGET integrated database retrieval system