KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001867Help
Entry
AgaP_AGAP001867   CDS       T01036                                 

Definition
AGAP001867-PA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Protein processing in endoplasmic reticulum
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP001867
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AgaP_AGAP001867
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AgaP_AGAP001867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1165 aa AA seqDB search
MLPTGTHPATAPSDGRASEVGKNGSTTATMSGSSIDNRITMMEQMIQNPRSTPSLSLPIS
TQPPANRFNRTGSGGMGGPNRPSLGLNLPIVSGTRRSESELKFQKIVDKSGLLKINDKIY
RTQLSDLEDLGELGNGTSGHVVKMRHNPSGAIIAVKQMRRTGNDEENKRIIMDLDVVLKS
ENCKYIVKCLGCFITDADVWICMELMTTCFDKLQKKSKKPVPEEILGKVTVATVRALAYL
KDNHRVIHRDVKPSNILIDDRGNIKLCDFGISGRLVDSNARTRSAGCAAYMAPERIDPAK
TVYDIRADVWSLGITLVELATGVFPYRGCVTDFEVLTQVLTSNPPRLPEDQNFSPEFRDF
VQLCLQKDYQARPKYPDLLRHAFLQRAEHDTTINVGEWFRNVAVNCGIQLTSTPPPPTAG
SSASVSSPPTWTASSEQTRIPTPLGSLTEVVQAQSNQQKQTIAIAASSIPIKSTATILSP
HIANEAPSNLSDLQQRSQHELNQQQQLLQSKLSNISLASSSSSTSAAAAAAAGSTPVPAS
SYTPTSSSSAAGAGAFDTRRSPSPQAYYLAKMQPKSAITSTSVPIASGGGPAFERNGSLE
PARKYKHSPFLSRRTASEYGNGSPKKESTLSSLGQSIFKNLTTSPFAQRKSLPPGESKLA
YPPPASPSPMPVASATIYANGGGGGGAGAGGMGSSPSSPLLLLRKAHHDGSETETQYKHL
HGNTSPIVLQRFYHQQNQLKEQQREALQQHHHHQQQQQQQQQQHQQQQQQVIYGYSSPSP
IPSASEASPRPIRYSPLPSHRTVHHGVHPVLSNTGGTTTLHQSAIPLYKHHEPAAPLAPS
QPSGIPVYQQQTTASPKHKSSSFFNTFSRGMKSGGRGDKVIDRGGTAAPPTMMSGAADRS
LYAGTTTTNTTHQTALYQHHHQGQPNTSSMLHRHGALSGISNGGGGGGAGLAMPEGSKED
ADIKRKFASFVKLNLSNNVTGASGTGTTTAGDRLTLKEKHLQQQQLLQQQQQFLLQQQQH
QQQHYVSSNPFDGMTAGGMGGVYGAGPYPSGGSSAASIVQPPSAIPQLAHVLNSPATDRR
HRSPDPPPRLNRGQSPLLLQRKLEQLGHTGSPLMNRRPFNSTSPSPPLPPRRASESAPGS
PQHLRARINYTPEPHRRPYHTTIEQ
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgacgggtacgcatccggccaccgcaccgtccgacggcagagctagcgaggtc
ggaaagaacggtagcaccaccgccaccatgtccggcagttcgatcgacaaccgcatcacg
atgatggaacagatgatccagaatccccgttccacgccttccctgtccctgccgatctcg
acgcagccgccagcgaatcgcttcaatcgcaccggaagcgggggcatgggtggacccaac
cgaccgtcgttgggattgaatctgcccattgtctccgggacgcggcggagtgaatcggaa
ctcaagttccagaagatcgtagacaagagcgggctgctgaagattaacgacaagatctac
cgtacgcagctcagcgacctggaggatttgggcgaacttgggaacggaaccagcgggcat
gtcgtgaagatgcgacacaatccgagtggagccatcattgctgtcaagcaaatgagacgc
accggaaacgacgaagaaaataaacgaatcataatggatctggacgtggtgctgaagtcg
gaaaactgcaagtacatcgtcaagtgtctcggttgcttcatcaccgatgcggacgtgtgg
atctgcatggagctgatgacgacgtgcttcgacaagctgcagaaaaagtccaaaaaaccg
gtaccggaggaaatcctcggcaaggtaacggtggcaacggtgcgcgcgctggcctacctc
aaggacaaccaccgggtcatccaccgggacgtgaagccctcgaacatcctgatcgacgac
cggggcaacataaagctgtgcgatttcggcatcagcggccggctggtggactcgaatgcc
cgtacccgttcggccgggtgtgctgcatacatggcgccggaacgaatcgatccagcaaaa
acggtgtacgacatccgggccgacgtgtggtcgctcggcatcacgctggtcgagctggct
acgggcgtctttccctatcgtggctgtgtgaccgacttcgaggtgctgacgcaggtgctc
acctctaacccgccccggctgcccgaggatcagaactttagtccggagtttcgcgacttt
gtgcagctgtgcctgcagaaggactatcaggcacggcccaagtatccggacctgctgcgg
cacgcgttcctgcagcgggccgagcacgacaccacgatcaacgtgggcgaatggttccgc
aatgtggcggttaactgcggcattcagctgaccagcacgccgccaccaccgaccgccgga
tcgtccgcttccgtcagctcacccccaacctggaccgcgtcgtcggaacaaaccagaata
ccgaccccgctcggaagcttgacggaagtagtccaggcgcagtcgaaccagcaaaagcaa
accatcgccatcgccgcctcgtcgatcccgatcaagtcaaccgcgaccatcctatccccc
cacattgccaacgaagcacctagcaacctgagcgatctgcagcagcggtcgcaacacgag
ctcaaccagcaacagcagctgctccagagcaaacttagcaacattagcctagcgtcctcg
tcgtcctccacctcggcagcagcagcggcggcggcaggatccacaccggtaccagcatcc
tcctacacgcctacctcgtcttcctcagcggcgggggcgggtgcgttcgatacacgccgc
tcgccctccccgcaggcctactatctagcgaaaatgcagccaaaaagtgccattactagc
accagcgtaccgatcgcgtcgggcggtgggccggccttcgaacgcaacggttcgctcgaa
ccggcccgaaagtacaaacactcgccgttcctgtcgcgccgcaccgcctccgagtatggg
aacggcagcccgaagaaggaatcgacgctgagcagtttggggcagagcatcttcaaaaac
ctgaccacatcaccgttcgcccagcggaaatcgcttccgcccggcgagtcgaagcttgcc
tatccgcccccggcctccccctcgccgatgcccgtagcgtccgcgacgatctatgcgaat
ggtggcggcggtggaggggccggtgccggtggtatgggcagcagtccttcctcgccgctg
ctgctgctccggaaggcacaccacgacggttcggaaacggaaacgcagtataaacatctg
cacggcaacactagtccaattgttcttcagcgattctaccaccaacagaatcaactgaaa
gagcaacaaagagaggcgctgcagcagcatcatcaccaccaacagcagcagcagcagcag
cagcagcagcatcaacagcaacagcagcaagtgatttacgggtactcctcaccatcgccg
ataccctcggcaagcgaagcgtcaccccggccaatccgctacagtccgctaccctcccat
cggaccgtacatcatggggtgcatccggtgctgagcaacaccggcggcaccaccaccctt
caccaaagcgccatcccgctctacaagcatcacgaaccggcggcgccgctagcaccatca
caaccttccgggattccggtgtaccagcagcaaaccaccgccagccccaagcacaaatcc
tcctccttctttaacacgttcagccgtggcatgaagagcggtggtcggggcgataaggtg
atcgatcggggtggcaccgccgcaccaccgaccatgatgagtggtgctgccgatcggtcg
ctgtatgccggcactaccaccaccaacaccactcaccaaacagcactgtaccaacatcat
catcaggggcagcctaatacgtcgtcgatgctgcatcggcacggtgcactcagtggaatt
agcaacggaggaggaggaggaggagcagggcttgcaatgccggaaggcagcaaagaagat
gcagatatcaagcgaaagtttgcctcattcgtgaagctaaacctcagcaacaatgttaca
ggagcgagcgggacgggcacgaccaccgccggcgacaggctaaccctgaaggagaaacat
ctacagcagcaacagctgctgcagcagcagcaacagtttctattgcaacagcagcagcat
cagcagcagcattatgtgtcgtcgaatcctttcgatggtatgacggcgggtgggatgggt
ggggtgtacggtgcgggaccgtacccttccggcgggtcgtccgcagcgtcgatagtacaa
cctccttccgccataccgcagctggcacatgtgctcaacagtccggcgactgatcggcgc
caccgcagcccagatccaccgcccaggttaaatcgtggtcaatcgccactgctacttcag
cgtaaactggaacagctcggtcacaccggctcaccgctgatgaatagaaggccattcaac
tctacctccccgtcacctcccctgccgccgcggcgcgcgtcggaaagtgctcccggttcg
ccgcaacacttgcgggcccgcatcaactacaccccggaaccgcaccggcgtccctatcac
acgacgatcgagcaatga

DBGET integrated database retrieval system